Johannessimatupang’s Weblog

Just another WordPress.com weblog

METODE PENELITIAN NOVEMBER PAGI DAN SORE


Halaman ini untuk peserta pagi dan sore. Untuk mengikuti perkuliahan ini silahkan peserta mengunduh pedoman pada lampiran ini.
Lampiran
BLog Pedoman MEP Pemasaran November 2011

Powerpoin Kuliah, Semua peserta  harus menguduh powerpoin, mencetak dan  membudel dalam satu map khusus, Metode Penelitian

Metode Penelitian Pemasaran Merancang Kuesioner Desember 2011

Metode Penelitian Pemasaran Rumusan Masalah Desember 2011

Metode Penelitian Pemasaran Sampling Desember 2011

Metode Penelitian Pemasaran Menulis Laporan

Proposal Tentatif  Januari 2012 Peserta pagi dan sore

Proposal Tentatif Lita N 2012

About these ads

November 30, 2011 - Posted by | Bahan Ajar, kompetensi, metode penelitian, penelitian pemasaran, Uncategorized

305 Komentar »

  1. TUGAS I (INDIVIDU)
    NAMA : ANGGIA AGUSTINI SAPUTRI
    NIM : C1B009120
    MGT G’09

    judul :
    ” PENGARUH WORD OF MOUTH (WOM) TERHADAP KEPUTUSAN PEMBELIAN PRODUK ELEKTRONIK BERMEREK TOSHIBA”

    Anggia, kamu bisa melanjuti judul ini dg membuat latar belakang sekitar 1 halaman saja yg membuat kamu harus menelitinya. Cari data tentang ranking penjualan Notebook misalnya dan bagaimana preferensi konsumen terhadap Thoshiba. Jangan lupa untuk seluruh peserta menuliskan apakah yang bersangkutan peserta pagi atau sore. sukses untuk semua.

    Komentar oleh Anggia Agustini Saputri | Desember 7, 2011 | Balas

    • iya pak trimakasih,,,
      bisa tidak pak kalau judul ini berkelanjutan untuk kedepannya/untuk di ajukan dalam proposal skripsi d smester depan??
      atau judul ini sudah ad dan tidak boleh lagi,

      Sasaran saya demikian, setiap mahasiswa harus yakin bahwa judul, bidang selama proses kuliah ini dilakukan, peserta menjadikannya Skripsi. Oleh karena itu setiap peserta saya haruskan

      Komentar oleh Anggia Agustini Saputri | Desember 7, 2011 | Balas

      • dengan judul saya ini, apakah sudah banyak yang menelitinya pak???

        Komentar oleh Anggia Agustini Saputri | Desember 7, 2011

      • maaf pak,
        judul saya, saya ganti dengan “Pengaruh Implementasi Relationship Marketing Terhadap Customer Loyality Pada Bank Mandiri Cabang Muaro Jambi di Jambi”
        mohon sarannya pak?? dan proposal tentatifnya akan saya kirim via email pak.
        terimakasih pak,

        Kalau sudah senang dg judul ini, kamu boleh menyusun proposal tentatif. Hanya peserta yg memiiki proposal tentatif yg akan diberi nilai semester.

        Komentar oleh Anggia Agustini Saputri | Desember 26, 2011

      • BAB I
        PENDAHULUAN

        1.1 Latar Belakang
        Perubahan dalam dunia usaha yang semakin cepat mengharuskan perusahaan untuk merespon perubahan yang terjadi, problem sentral yang dihadapi perusahaan-perusahaan saat ini adalah bagaimana perusahaan tersebut menarik pelanggan dan mempertahankanya agar perusahaan tersebut dapat bertahan dan berkembang, tujuan tersebut akan tercapai jika perusahaan melakukan proses pemasaran.
        Pemasaran merupakan salah satu kegiatan pokok yang dilakukan oleh perusahaan untuk mempertahankan kelangsungan hidupnya, tetapi dalam pemasaran modern seperti ini paragdima pemasaran telah bergeser, tidak hanya menciptakan transakasi untuk mencapai keberhasilan pemasaran tetapi perusahaan juga harus menjalin hubungan dengan pelanggan dalam waktu yang panjang. Paragdima tersebut disebut relationship marketing dasar pemikiran dalam praktek pemasaran ini adalah, membina hubungan yang lebih dekat dengan menciptakan komunikasi dua arah dengan mengelola suatu hubungan yang saling menguntungkan antara pelanggan dan perusahaan (Chan S, 2003).
        Relationship marketing mampu memperdayakan kekuatan keinginan pelanggan dengan tekanan teknologi informasi untuk memberikan kepuasan pada pelanggan. Cakupannya meliputi tuntutan manajemen mutu terpadu secara global untuk menghadapi kebutuhan bisnis pelanggan dengan lebih agresif. Strategi bisnis difokuskan pada kelanggengan dan pemuasan pelanggan serta bekerja untuk mengantisipasi kebutuhan serta penyesuaian hasil produk.
        Salah satu indikator yang cukup handal untuk kelangsungan hidup dan keuntungan dari suatu proses bisnis adalah kelanjutan dari kepuasan pelanggan. Diperkirakan untuk menarik satu pelanggan baru diperlukan biaya mulai dari lima sampai lima belas kali, dibandingkan dengan menjaga hubungan dengan satu pelanggan lama.
        Pada dasarnya relationship marketing adalah hubungan dan ikatan jangka panjang antara produsen, konsumen dan pemasok serta pelaku lainnya. Esensi relationship marketing paling tidak menyangkut hubungan yang langgeng dan pertukaran yang terus menerus dan dituntut untuk saling kepercayaan dan ketergantungan. Sehingga dalam konsep relationship marketing, pemasar sangat menekankan pentingnya hubungan baik jangka panjang dengan konsumen dan infrastruktur pemasaran, yang dapat menciptakan kesadaran dalam bentuk hubungan dan komitmen yang menyeluruh.
        Relationship marketing diartikan sebagai menarik, memelihara dan meningkatkan hubungan dengan pelanggan (Berry, 1995 dalam Wibowo S, 2006). Relationship marketing lebih merupakan pendekatan bersifat jangka panjang, dimana hal ini berbeda dengan pendekatan pemasaran transaksional yang lebih berorientasi jangka pendek. Tujuan dari pemasaran transaksional adalah untuk mendapatkan pelanggan semata, sedangkan tujuan dari relationship marketing adalah untuk mendapatkan dan mempertahankan pelanggan.
        Relationship marketing biasanya lebih sering digunakan dalam perusahaan jasa, sedangkan pemasaran transaksional lebih aplikatif dan sesuai untuk pemasaran bagi perusahaan yang menghasilkan produk manufaktur (Gronroos, 1995 dalam Wibowo S, 2006). Penelitian ini memfokuskan pada implementasi proses relationship marketing pada perusahaan perbankan, karena perbankan merupakan salah satu penyedia jasa yang menerapkan adanya keramahtamahan dalam hubungan dengan konsumen.
        Alasan yang mendasari topik penelitian ini adalah bahwa setiap perusahaan jasa dalam mempertahankan konsumenya, perusahaan harus mampu menjalin hubungan yang baik. Relationship marketing merupakan strategi yang dapat diimplementasikan untuk menunjang tercapainya tujuan tersebut. Dan penelitian yang berkaitan dengan relationship marketing pada perusahaan perbankan belum banyak dilakukan. Penelitian ini memfokuskan pada implementasi proses relationship marketing pada suatu perusahaan jasa Bank Mandiri cabang Muaro Jambi di Jambi.
        Bank Mandiri adalah sebuah perusahaan yang bergerak dalam bidang pelayanan jasa dimana pelanggannya memiliki kebutuhan jangka panjang (long time horirizon), dengan kondisi tersebut Bank Mandiri ini menyadari pentingnya konsep relationship marketing. Hal tersebut diwujudkanya dengan menerapkan relationship marketing pada Bank Mandiri. Konsep ini mengharapkan adanya inovasi dan peningkatan fasilitas agar dapat menciptakan loyalitas konsumen terhadap Bank Mandiri sehingga tercipta hubungan jangka panjang yang harmonis antara perusahaan dan konsumen.
        Bank Mandiri merupakan salah satu perusahaan yang bekerja dalam bidang profit atau sifatnya mencari keuntungan. Bank Mandiri adalah perbankan yang mempunyai cabang maupun unit di hampir seluruh pelosok Indonesia. Relationship Marketing di Bank Mandiri cabang Muaro Jambi di Jambi menarik diteliti karena bank ini adalah cabang yang tidak mempunyai unit, sehingga bank ini hanya memfokuskan pada keuntungan atau menjaga agar nasabah tetap dipuaskan dengan pelayanan dari Bank Mandiri. Dalam proses pemasaran di Bank Mandiri cabang Muaro Jambi di Jambi, benar-benar melibatkan nasabah.
        Berdasarkan latar belakang diatas maka penulis bermaksud mengadakan penelitian dengan judul “Pengaruh Implementasi Relationship Marketing Terhadap Customer Loyalty Pada Bank Mandiri Cabang Muaro Jambi di Jambi”.

        1.2 Batasan Masalah
        Dalam penelitian untuk mengembangkan pengetahuan yang mendalam objek yang diteliti dengan tetap mempertahankan keutuhan dari objek, sehingga data yang dikumpulkan bisa dipelajari sebagai keseluruhan yang berintegrasi, maka perlu diberikan batasan masalah sebagai berikut :
        Relationship marketing input dalam penelitian ini adalah understanding customer expectation, building service partnership, total quality management dan empowering employees, sedangkan relationship marketing outcomes dalam penelitian ini dibatasi pada customer loyalty.
        1.3 Rumusan Masalah
        Berdasarkan latar belakang masalah tersebut diatas, peneliti mencoba mengidentifikasi permasalahan sebagai berikut :
        1.3.1 Apakah Understanding Customer Expectation, Building Service Partnership, Total Quality Management dan Empowering Employees berpengaruh signifikan terhadap Customer Loyalty pada Bank Mandiri cabang Muaro Jambi di Jambi?
        1.3.2 Apakah Understanding Customer Expectation, Building Service Partnership, Total Quality Management dan Empowering Employees secara serentak berpengaruh signifikan terhadap Customer Loyalty pada Bank Mandiri cabang Muaro Jambi di Jambi?

        1.4 Tujuan Penelitian
        1.4.1 Untuk menguji pengaruh dari Understanding Customer Expectation, Building Service Partnership, Total Quality Management dan Empowering Employees terhadap Customer Loyalty pada Bank Mandiri cabang Muaro Jambi di Jambi.
        1.4.2 Untuk menguji pengaruh dari Understanding Customer Expectation, Building Service Partnership, Total Quality Management dan Empowering Employees secara serentak terhadap Customer Loyalty pada Bank Mandiri cabang Muaro Jambi di Jambi.
        1.5 Manfaat Penelitian
        Beberapa manfaat yang diharapkan dari terlaksananya penelitian ini adalah sebagai berikut :
        1.5.1 Bagi peneliti, penelitian ini diharapkan bisa digunakan untuk menerapkan ilmu yang telah di dapat dibangku kuliah ke dunia usaha yang sebenarnya.
        1.5.2 Bagi pihak perusahaan, penelitian ini diharapkan bisa memberikan kontribusi dalam pengambilan kebijakan yang berkaitan dengan upaya membangun hubungan baik dengan konsumen dan referensi bagi pengembangan riset dikemudian hari.
        1.5.3 Bagi pihak Universitas, memberikan informasi sebagai bahan studi lebih lanjut bagi yang ingin mengadakan penelitian yang berkaitan dengan topik yang sama serta memberikan sumbangan bagi karya tulis ilmiah di perpustakaan.

        Anggi sampel dan populasi belum dijelaskan. Tambahkan daftar pustaka.

        Komentar oleh anggiaagustinisaputri | Januari 6, 2012

      • BAB II

        A. Obyek / Populasi Penelitian
        Dalam penulisan skripsi ini yang menjadi obyek penelitian adalah Bank Mandiri cabang Muaro Jambi di Jambi. Sedangkan subyek/populasi dari penelitian ini adalah nasabah Bank Mandiri cabang Muaro Jambi di Jambi.
        B. Jenis Data
        Data yang digunakan dalam penelitian ini adalah data primer, yang diperoleh langsung dari responden.
        C. Metoda Pengumpulan Data
        Untuk memperoleh data yang relevan terhadap penelitian ini, maka penulis menggunakan kuesioner sebagai alat pengumpulan data. Kuesioner diberikan secara langsung pada responden.
        D. Teknik Pengambilan Sampel
        Sampel adalah sebagian dari populasi yang diteliti. Teknik sampling dalam penelitian ini adalah metode convenience sampling (sampling kemudahan) yaitu pengambilan sampel dari elemen populasi yang datanya mudah diperoleh oleh peneliti (Soehardi, S 1999). Sehingga peneliti memiliki kebebasan untuk memilih sampel yang paling cepat dan murah. Jumlah sampel yang diambil adalah 100 responden karena berdasarkan tingkat keyakinan peneliti bahwa 100 responden sudah cukup mewakili dari populasi

        Komentar oleh anggia agustini saputri | Januari 12, 2012

      • Daftar Pustaka

        Chan, Syafruddin, 2003, Relationship Marketing : Inovasi Pemasaran Yang Membuat Pelanggan Bertekuk Lutut, Gramedia, Jakarta.

        Wibowo, S., 2006, “Implementasi Releationship Marketing Pada Industri Hospitality”, Utilitas, Vol 14 No 2, Juni, Hal 178-196.

        Komentar oleh anggia agustini saputri | Januari 25, 2012

  2. TUGAS I INDIVIDU
    NAMA : LITA NGULIA
    NIM : C1B009049
    KELAS : MGT A 2009
    JUDUL : ANALISIS MINAT MASYARAKAT UNTUK BERTRANSAKSI PADA PERBANKAN SYARIAH

    Lita ini perlu diperjelas, konsep minat hendaknya digantikan dg salah satu bidang dalam ilmu pemasaran. Kalau hendak menarik judulmu, coba bandingkan antara B. Syariah dan bukan untuk jenis produk yg sama. Sukses selalu.

    Komentar oleh LITA NGULIA | Desember 7, 2011 | Balas

    • iya pak terima kasih pak atas sarannya
      bagaimana kalau saya mengganti judulnya pak
      ini judul saya pak
      ” ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI MINAT BELI KONSUMEN PADA IKLAN FLEXY”

      Lita, anda mau melihat iklan pada flexy atau iklan tentang flexy.

      Komentar oleh LITA NGULIA | Desember 11, 2011 | Balas

      • iklan televisi tentang produk flexy pak.

        Kalau mau tentang Flexy, bidang yg diteliti harus lebih jelas. Kalau iklan dan pengaruhnya terhadap pengambilan keputusan sudah banyak. Mungkin yg perlu diketahui lebih jauh adalah AS murah yg mempromosikan SERBU. Sejauh mana SERBU menjadi atribut pilihan untuk menjadikan orang menggunakan AS dan bertahan di AS. Teliti lebih lanjut.

        Komentar oleh LITA NGULIA | Desember 15, 2011

      • pak saya ingin meneiliti minta konsumen dalam membeli komputer dijambi. apakah bisa dilanjutkan pak. ini judul yang mau saya ambil.
        “ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI PERILAKU KONSUMEN DALAM MEMBELI KOMPUTER DIJAMBI”

        Lita ambil satu merek komputer baru itulah yg dibahas.

        Komentar oleh LITA NGULIA | Desember 28, 2011

      • jadi saya mengambil judul ini saja pak “ANALISIS PENGARUH ELEMEN-ELEMEN EKUITAS MEREK TERHADAP KEPUTUSAN PEMBELIAN PADA NOTEBOOK TOSHIBA DIJAMBI”

        jika bapak menyetujuinya saya akan melanjutkan untuk membuatnya. trims pak.

        Saya setuju judul di atas, walau ada nanti perubahan. Silahkan tulus proposal tentatif.
        Lita jangan pakai istilah elemen, pakai dimensi. Untuk ini gunakan dimensi yg diajukan oleh Kotler.

        Komentar oleh LITA NGULIA | Januari 5, 2012

  3. TUGAS I (INDIVIDU)
    NAMA : EVANINA SIANTURI
    NIM : C1B009006
    MGT A’09

    Judul :
    “Analisis Persepsi Konsumen Terhadap Pajak Penjualan Barang Mewah (PPnBM) Pada Barang Elektronika di Kota Jambi”

    Eviana Judulmu menarik, belum banyak msw meneliti ini, tapi apakah anda yakin memperoleh dtanya. Kalau soal pajak, kenapa tidak coba teliti pajak restoran di kota Jambi? Sukses selalu.

    Komentar oleh EVANINA SIANTURI | Desember 7, 2011 | Balas

    • Terima kasih pak, saya dari kelas pagi.
      saya jg ragu dengan datanya pak karena cakupan nya terlalu luas pakai “kota jambi”. tapi dalam studi kasusnya saya mau membandingkan antara 2 toko elektronik.

      kalau soal restoran itu bukan masalah pajak barang mewah lagi kan pak ?
      saya harus ganti objek penelitian ya pak ?

      Komentar oleh EVANINA SIANTURI | Desember 8, 2011 | Balas

      • maaf sebelumnya pak, tolong beri komentarnya, biar saya bisa lanjutkan proposal saya ini..

        Komentar oleh EVANINA SIANTURI | Desember 20, 2011

      • BAB I
        PENDAHULUAN
        1.1 Latar Belakang
        Sistem Pajak Pertambahan Nilai (PPN) baru diterapkan pada tahun 1983, dandiatur dalam Undang-Undang Nomor 8 Tahun 1983 yang kemudian disempurnakanoleh Undang-Undang Nomor 11 Tahun 1994 dan disempurnakan kembali di Undang-Undang Nomor 18 Tahun 2000,kemudian yang terbaru adalah Undang-Undang PajakPertambahan Nilai (PPN) Nomor 42 Tahun 2009 yang mulai akan berlaku padatanggal 1 April 2010. Pajak ini dimaksudkan sebagai pengganti pajak penjualan danpajak penjualan impor.Dibandingkan dengan dua pajak tersebut, Pajak PertambahanNilai (PPN) memiliki basis yang lebih luas karena tidak hanya meliputi produsenpabrikan, tetapi juga mencakup distributor, agen besar dan penjual eceran.Ketikaketentuan Pajak Pertambahan Nilai (PPN) diterapkan pada tahun 1983, makapenerimaan Pajak Pertambahan Nilai (PPN) langsung meningkat tajam.

        Tingginya penerimaan Pajak Pertambahan Nilai (PPN) disebabkan oleh dua faktor, yaitu adanya basis pajak yang lebih luas dan tambahan Pajak Penjualan atas BarangMewah (PPnBM) yang tarifnya 10% diatas tarif Pajak Pertambahan Nilai (PPN).Karena Pajak Pertambahan Nilai (PPN) ini merupakan pengganti pajak penjualanatau timbul karena adanya barang atau jasa yang ditransaksikan maka PajakPertambahan Nilai (PPN) termasuk pajak obyektif.

        Tapi kemudian menjadi masalah ketika definisi barang mewah di masyarakatcepat berubah dan bergeser.Contoh yang mudah ditemui adalah telepon seluler.Limatahun yang lalu telepon seluler merupakan yang mewah karena selain harganya yangmahal juga jangkauan penerimaannya juga terbatas untuk daerah tertentu saja yangkebanyakan adalah perkotaan. Tapi lain yang terjadi sekarang hampir semua lapisanmasyarakat mengkonsumsi telepon seluler bahkan sudah menjadi bagian darikebutuhan sehari-hari. Dilain pihak peraturan yang mengatur barang kena pajak yangtergolong mewah tidak bisa mengantisipasi perubahan yang terjadi di masyarakattersebut.

        Oleh karena itu penulis ingin mengangkat uraian diatas dengan judul “Persepsi Konsumen Terhadap Pajak Penjualan Barang Mewah (PPnBM) Pada Barang Elektronika di Kota Jambi”

        1.2 Permasalahan dan Batasan Masalah
        Berdasarkan uraian diatas maka permasalahan yang timbul adalah Bagaimana persepsi konsumen terhadap keberadaan Pajak Penjualan Barang Mewah (PPnBM) barang elektronika di kota Jambi.

        Saya suka judul ini, tapi harus diingat bagaimana anda menemukan sampel siapa yg mengetahui tentang adanya pajak barang mewah.

        Komentar oleh EVANINA SIANTURI | Desember 21, 2011

      • pak ini judul baru yang ingin saya coba ” ANALISIS PERILAKU KONSUMEN DALAM BERBELANJA PADA HARGA KHUSUS DAN HARGA BIASA DI PASAR SWALAYAN”
        tolong beri komentarnya pak

        Komentar oleh EVANINA SIANTURI | Januari 4, 2012

      • Harga khusus itukan promosi, lantas Swalayannya sebutkan agar bisa diteliti. Artinya gunakan istilah standar saja.

        ________________________________

        Komentar oleh johannessimatupang | Januari 4, 2012

      • Salam pak jo,
        trimkasih buat masukannya..
        saya hanya menambahkan nama swalayannya jadi seperti ini “ANALISIS PERILAKU KONSUMEN DALAM BERBELANJA PADA HARGA KHUSUS DAN HARGA BIASA DI TROPI SWALAYAN”
        tolong beri komentarnya lagi pak………:)

        Komentar oleh EVANINA SIANTURI | Januari 6, 2012

      • salam pak jo’
        ini proposal tentatif saya, tolong beri komentarnya pak…

        Judul : Analisis Perilaku Konsumen Dalam Berbelanja Pada Harga Khusus dan Harga Umum Di Pasar Swalayan MANDALA Jambi”
        BAB 1
        PENDAHULUAN
        1.1 Latar Belakang
        Pembangunan ekonomi negeri kita yang telah berlangsung selama tigapuluh tahun terakhir ini, ternyata telah melahirkan suatu kelompok sosial yang konsumtif. Globalisasi secara konkret menciptakan penduniaan budaya konsumtif yang mengancam paradaban manusia. Budaya konsumtif yang dikemas sebagai gaya hidup internasional dan merupakan simbol modernitas dan instan.

        Di indonesia akhir-akhir ini pasar swalayan berkembang sangat cepat. Pasar swalayan dapat diartikan sebagai tipe toko eceran yang bergarak dalam kebutuhan makanan dan miniman serta kebutuhan rumah tangga lainnya, yang beroperasi atas dasar swalayan dengan pelayan yang sedikit mungkin menawarkan harga yang menawan dan biasanya ada tempat parkir yang luas (Suud, 1994:14). Pasar swalayan memiliki keunggulan dari pasar tradisional yakni harga barang yang murah, kemasan rapi, jenis barang yang lengkap, situasi yang bersih dan nyaman, menjadikan pasar swalayan sebagai sebuah one stop shopping. Dalam hal ini, sesuatu yang diingin masyarakat adalah bagaimana cara untuk mendapatkan barang-barang yang dibutuhkan serta menyediakan beranekaragam produk dan alternatif pilihan, harga bersaing, pelayanan dan fasilitas yang memuaskan serta suasana berbelanja yang nyaman.

        Untuk memahami kebutuhan konsumen bukanlah hal yang mudah dan sederhana, tetapi bukan hal yang mustahil untuk melakukannya. Menganalisis perilaku konsumen lebih dalam dan berhasil apabila perusahaan memahami aspek-aspek psikologis manusia secara keseluruhan, kekuatan faktor sosial dan budaya, prisip-prinsip ekonomis dan strategi pemasaran. Kemampuan dalam menganalisis perilaku konsumen berarti berhasil dalam menyelami jiwa konsumen dalam memenuhi kebutuhannya. Syarat yang harus dipenuhi oleh suatu perusahaan agar sukses dalam persaingan adalah berusaha mencapai tujuan untuk menciptakan dan mempertahankan pelanggan. Dalam menghadapi persaingnya, perusahaan harus mempunyai strategi dan ketegasan langkah yang harus dilaksanakan sesuai dengan sifat dan bentuk pasar yang dihadapinya. Strategi pasar itu meliputi pelayanan yang memuaskan, harga yang lebih murah ditambah potongan harga apabila pembelian dalam jumlah banyak, produk yang lebih bermutu, kemasan yang menarik, serta ditunjang lokasi yang strategis dan tempat yang nyaman akan mempengaruhi keputusan konsumen untuk berbelanja.

        Sebuah pandangan yang tidak aneh lagi di kalangan masyarakat yaitu berbelanja saat diskon besar-besaran adalah hobi baru bagi para penggemar belanja. Ini adalah penawaran diskon ‘besar-besaran’ hingga 80% yang dilakukan oleh beberapa pasar swalayan. Program potongan harga/harga khusus ini ternyata mampu menyedot ribuan orang untuk berbondong-bondong datang ke pusat perbelanjaan sehingga menyebabkan kemacetan jalan menuju pusat perbelanjaan dan antrian panjang saat berbelanja. Mereka rela antri berjam-jam dan berdesak-desakan demi untuk mendapatkan harga diskon untuk produk-produk yang mereka inginkan.

        Jadi masyarakat pada masa sekarang tidak bisa dipisahkan dari konsumsi dan pasar khususnya pasar modern atau pasar swalayan karena masyarakat membutuhkan pasar guna memenuhi kenutuhan mereka. Dan pasar swalayan MANDALA Jambi merupakan salah satu pasar swalayan terbesar dan berada di pusat kota Jambi. Atas dasar uraian di atas maka penulis tertarik untuk melakukan penelitian dengan judul “Analisis Perilaku Konsumen Dalam Berbelanja Pada Harga Khusus dan Harga Umum Di Pasar Swalayan MANDALA Jambi”.

        1.2 Rumusan Masalah
        Berdasarkan uraian latar belakang diatas maka dapat diidentifikasikan beberapa masalah, yaitu sebagai berikut :
        1.2.1. Bagaimana Masyarakat Jambi menyikapi adanya pasar swalayan MANDALA Jambi?
        1.2.2. Bagaimana Masyarakat Jambi menyikapi ketika ada harga khusus dan harga umum di pasar swalayan MANDALA ?
        1.2.3. Adakah perbedaan ketika ada harga khusus dan harga umum di pasar swalayan MANDALA ?

        1.3 Tujuan Penelitian
        Sesuai dengan permasalahan di atas, tujuan yang hendak dicapai dalam penelitian ini adalah sebagai berikut:
        1.3.1 Untuk mengetahui aktivitas pembeli dalam berbelanja di pasar swalayan MANDALA Jambi.
        1.3.2 Untuk mengetahui bagaiman perilaku Masyarakat Jambi dalam berbelanja pada harga Khusus dan harga umum di pasar swalayan MANDALA Jambi.

        1.4 Manfaat Penelitian
        Manfaat yang diperoleh dari penelitian ini dapat berupa manfaat teoritis dan manfaat praktis.
        1.4.1. Manfaat teoritis dalam penelitian
        1. Penelitian ini diharapkan dapat memberikan sumbangan yang berharga bagi perkembangan ilmu pengetahuan terutama yang berkaitan dengan disiplin ilmu pemasaran dengan lingkup promosi dalam hal bagaimana perilaku masyarakat Jambi dalam berbelanja pada saat harga khusus dan harga umum di pasar swalayan MANDALA Jambi.
        2. Dapat memberikan wawasan kepada pembaca tentang perilaku konsumtif masyarakat Jambi.
        3. Hasil penelitian ini diharapkan menjadi referensi sehingga dapat dibaca.
        1.4.2. Manfaat praktis dari penelitian
        1. Sebagai bahan pembanding studi mendatang
        2. Memberikan informasi bagi pemerintah dan masyarakat setempat untuk mengetahui bagaimana perilaku masyarakat Jambi dalam berbelanja pada saat harga khusus dan harga umum di pasar swalayan MANDALA Jambi.

        BAB III
        METODE PENELITIAN
        3.1. Populasi
        Populasi adalah wilayah generalisasi yang terdiri atas : objek/subjek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulannya. Populasi bukan hanya orang, tetapi juga objek dan benda-benda alam yang lain. Populasi juga bukan sekedar jumlah yang ada pada objek/subjek yang dipelajari, tetapi meliputi seluruh karateristik/ sifat yang dimiliiki subjek/objek tersebut (Sugiono, 2010, hal 115).

        Dalam penelitian ini yang menjadi populasi adalah Masyarakat Jambi yang berbelanja ke pasar swalayan MANDALA Jambi dengan jumlah populasi sebanyak 210.000 orang pada tahun 2011. Dasar dalam pengambilan populasi ini adalah perbedaan konsumen berbelanja pada harga umum dan harga khusus (seperti bulan puasa dan bulan natal) dimana pada bulan ini sering dilakukan diskon besar-besaran. Pengambilan datanya hasil dari wawancara langsung bersama pihak swalayan MANDALA dengan mengambil rata-rata pembelanja dengan harga umum sekitar 150.000 orang dan pada bulan dengan tawaran harga khusus sekitar 60.000 orang. Dengan perhitungan harga umum terjadi dalam 10 bulan × 30 hari = 300 hari × 500 orang pembelanja setiap harinya = 150.000 orang. Dan harga khusus terjadi dalam 2 bulan × 30 hari = 60 hari × 1000 orang pembelanja = 60.000. Hal ini terjadi karena adanya harga khusus yang mengakibatkan jumlah pembeli membengkak dua kali lipat.

        3.2. Sampel
        Dalam proposal tentatif ini metode pengambian sampel yang digunakan adalah metode Snow Boling, yaitu teknik penentuan sampel yang mula-mula jumlahnya kecil, kemudian membesar. Ibarat bola salju yang mengelinding yang lama-lama menjadi besar. Hal ini dikarenakan jumlah masyarakat Jambi yang berbelanja ke swalayan MANDALA relatif banyak sehingga mempermudah untuk memilih responden untuk dijadikan sampel dalam penelitian ini.
        Melihat jumlah populasi yang sangat banyak maka untuk menentukan jumlah sampel peneliti menggunakan rumus Issac dan Michael ( dalam Prof. Dr. Sugiono 1999), dengan rumus sebagai berikut:
        n= N / N(d)2+1
        210.000 / 210.000 (0.1)2 + 1
        = 100 sampel
        dimana : n = jumlah sampel
        N = jumlah populasi
        d = batas akhir
        bilangan 2 adalah pangkat

        Responden yang menjadi sampel adalah para pembeli produk-produk kebutuhan di swalayan MANDALA yang telah dewasa, laki-laki maupun perempuan dengan pembelian yang berulang-ulang, agar jawaban lebih objektif.

        3.3.Operasional Variabel
        Adapun operasional variable yang digunakan dapat dilihat sebagai berikut :
        3.3.1.Konsep Variabel
        1. Jenis Kelamin
        2. Umur
        3. Pekerjaan
        4. Penghasilan
        5. Alasan Berbelanja ke Swalayan MANDALA
        6. Keunggulan swalayan MANDALA

        3.3.2.Defenisi
        1. Sifat jasmani atau rohani yang dapat membedakan dua mahluk sebagai laki-laki atau perempuan.
        2. Usia
        3. Aktifitas untuk melakukan sesuatu kegiatan
        4. Sesuatu yang dapat dari jerih payah kita sendiri
        5. Azaz pembelanjaan terhadap barang dan jasa yang biasanya terjadi lebih dari satu kali
        6. Swalayan MANDALA merupakan swalayan yang menyediakan barang-barang dengan harga yang terjangkau

        3.3.3.Pengukuran
        1. Pria,wanita
        2. Dari umur
        17-25
        26-40
        40
        3. Pelajar
        Mahasiswa
        Karyawan
        4. Dari 500.000 keatas
        5. Tarif pembelanjaan di swalayan MANDALA yang relatif murah
        6. Biaya pembelian barang-barang yang relatif murah ditambah dengan diskon-diskon pada waktu-waktu tertentu
        3.3.4.Skala
        1. Odinal
        2. Interval
        3. Nominal
        4. Interval
        5. Nominal
        6. Odinal

        DAFTAR PUSTAKA
        Sugiono. 2010. Metode Penelitian Bisnis. Malang: Alfabeta

        Kotler, philip. 2005. Manajemen Pemasaran. Jakarta: Indeks

        Setiadi, J. Nugroho. 2003. Perilaku Konsumen. Jakarta: Prenada Media

        Enggel, Blackwell, Miniard. 1994. Perilaku Konsumen (terjemahan). Jakarta: Binarupa Aksara

        Sulahuddin. 2009. Karakteristik Pelanggan Speedy di Kota Jambi. Skripsi Fakultas Ekonomi, Universitas Jambi

        Engel, James F.Blackwell, Roger D dan Miniard. 1992. Consumer Behavior. Chicago: The Dryden Pers

        Sembiring, JJ Amstrong. 2007 Konsumerisme Media. http://rumahkiri.net/index.php?option=com.content&task=view&id=1044&Itemid=262…….110507

        Solomon, Michael R. 2002. Consumer Behavior: Buying, Having and Being, 5 edition. New Jersey: Prentice Hall, inc

        Schiffman, Leon G dan Lieslie Lazar kanuk. 2000. Consumer Behavior. USA: Prentice Hall

        Judulmu ok saja, tapi sampel dan populasi tentukan lebih cermat. Sementara variabel yg dijadikan variabel penelitian periksa lagi teori yg gdigunakan.

        Komentar oleh EVANINA SIANTURI | Januari 11, 2012

  4. TUGAS INDIVIDU
    NAMA :FRANSISCA YULIANTI
    NIM : C1B009030
    MGT “A”

    JUDUL: “Analisis SWOT sebagai dasar perumusan strategi pemasaran berdaya saing.”

    Fransisca, ini perlu ada kasus sehingga terlihat pembedanya dg pelajaran pada mata kuliah.

    Komentar oleh fransisca yulianti | Desember 7, 2011 | Balas

  5. saya mengambil studi kasus pada dealer yamaha mataram sakti,apakah judul ini bisa direkomendasikan pak?

    Rumah sakit boleh saja, tapi belum ada masalah atau bidang yg dijadikan fokus. Terus kerjakan.

    Komentar oleh fransisca yulianti | Desember 7, 2011 | Balas

    • masalah atau bidang yang bagaimana pak? saya kurang jelas pemahamannya pak

      Pemilihan judul harus dibarengi dg pemahaman bahwa dalam pengamatan peneliti ada masalah. Misalnya, kalau hendak menggunakan analisis SWOT, perlu dijelaskan dulu apa yang mendasari kenapa ini jadi alasan.

      Komentar oleh fransisca yulianti | Desember 7, 2011 | Balas

      • alasan saya mengambil judul ini karena di kota Jambi sendiri semakin banyak orang memiliki kendaraan bermotor,disetiap keluarga rata-rata minimal memiliki 1 unit kendaraaan bermotor,maka saya ingin meneliti bagaimana perusahaan dapat meningkatkan pemasaran produk perusahaannya yang bersaing dengan perusahaan lain dan dapat memberikan layanan yg berkualitas dan memuaskan konsumennya.bagaimana pendapat bpk tentang masalah ini,dan apakah saya dapat melanjutkan analisis tersebut??
        mohon sarannya pak jo

        Komentar oleh fransisca yulianti | Desember 20, 2011

    • Yulianti, proposal tentatifmu belum diterima.

      Komentar oleh johannessimatupang | Januari 12, 2012 | Balas

      • BAB I
        PENDAHULUAN
        LATAR BELAKANG MASALAH

        Perkembangan bisnis belakangan ini semakin menonjol akan persaingan, perubahan dan ketidakpastian. Keadaan ini menimbulkan persaingan yang sangat signifikan antar perusahaan yang bergerak di bidang yang sama, dikarenakan volume produk yang semakin meningkat, maupun bertambah pesatnya perkembangan teknologi. Hal ini memaksa perusahaan untuk lebih memperhatikan lingkungan yang dapat mempengaruhi perusahaan, agar perusahaan mengetahui pemasaran apa dan bagaimana yang harus diterapkan dalam perusahaannya. Oleh sebab itu, persaingan sangat penting bagi keberhasilan atau kegagalan suatu perusahaan (Porter, 1993), dimana pesaing yang menggunakan pendekatan pasar adalah perusahaan yang memuaskan kebutuhan pelanggan yang sama. Sehingga, perusahaan harus lebih cermat membaca dan mengamati keadaan pasar sehingga dapat menciptakan produk yang berkualitas, memberikan pelayanan yang berkualitas dan memuaskan konsumen agar dapat memenangkan persaingan.
        Menurut Andriansyah (2007), persaingan bisnis sesungguhnya adalah dimana layaknya seperti arena pertandingan, maka perusahaan menggunakan berbagai jurus-jurus “sakti dan pamungkas” agar bisa segera “menjatuhkan” lawan. Dalam konteks ini, sedikit saja perusahaan melakukan kesalahan dalam pengambilan keputusan bisnis dapat berdampak pada merosotnya penjualan produk yang ditawarkan perusahaan terhadap produk kompetitor, begitu pula sebaliknya.
        Perusahaan perlu mengenali kekuatan dan kelemahan perusahaan dalam persaingan. Hal ini sangat membantu perusahaan dalam mengenali diri serta memanfaatkan peluang yang ada dan menghindari atau meminimalkan ancaman. Pernyataan ini juga di ungkapkan oleh Guiltinan (1994), dimana dalam menentukan strategi bersaing dan mengambil keputusan seorang manajer harus mengenali apa kelemahan, kekuatan, peluang, ancaman yang dimiliki perusahaan serta mengenali keunggulan pesaing yang mungkin di miliki.
        Perusahaan mau tidak mau dituntut untuk selalu melakukan inovasi dalam strategi bersaing. Dimana strategi bersaiang merupakan upaya mencari posisi bersaing yang menguntungkan dalam suatu industri atau arena fundamental dimana persaingan berlangsung. Selain itu teori pemasaran modern menyatakan bahwa kunci sukses sebuah perusahaan bersaing tergantung pada penyasuaian secara dinamis terhadap lingkungan yang kompleks dan berubah-ubah.
        Suatu perusahaan dapat mengembangkan strategi bersaing dengan cara mencari kesesuaian antara kekuatan internal dan kekuatan eksternal perusahaan tersebut. Pentingnya strategi adalah alat untuk mencapai tujuan perusahaan dalam jangka panjang dan terus-menerus dilakukan berdasarkan sudut pandang tentang apa yang dihadapi oleh para pesaing dimasa depan untuk mencapai keunggulan bersaing. Pentingnya perusahaan mengetahui faktor-faktor kunci sukses internal dan internal dalam lingkungan perusahaan merupakan nilai lebih untuk daya saing perusahaan itu sendiri dalam menghadapi pesaing mereka.

        Faktor-faktor lingkungan perusahaan sangat penting bagi manajer atau manajemen puncak adalah:
        Bahwa perusahaan tidak berdiri sendiri melainkan berinteraksi dengan lingkungan dalam perusahaan itu sendiri.
        Pengaruh lingkungan sangatlah kompleks dan dapat mempengaruhi masing-masing bagian pada tiap bagian perusahaan.
        Pemasaran seperti halnya dengan ilmu pengetahuan bersifat dindamis dan selalu mengalami perunbahan. Perubahan dalam dunia pemasaaran merupakan suatu keharusan karena, dunia bisnis sebagai induk dari pemasaran terus-menerus berubah menyesuaikan diri dengan kemajuan jaman (Gusnur, 2008). Pemasaran di suatu perusahaan, selain bertindak dinamis juga harus selalu menerapkan prinsip-prinsip unggul dimana perusahaan harus meninggalkan kebiasaan yang lama yang sudah tidak berlaku para era sekarang. Pada era sekarang produsen tidak dapat memaksakan kehendak terhadap pembelian produk konsumen.
        Hal ini juga terjadi pada PT. Yamaha Mataram Sakti di Jambi, Mataram Sakti merupakan sebuah dealer resmi sepeda motor yamaha yang berkantor pusat di Jambi. Selain menjadi dealer asli yamaha, PT. Yamaha Mataram Sakti memberikan pelayanan lain seperti showroom, bengkel, service, dan menyediakan suku cadang bagi sepeda motor yamaha. Dibidang penjualan, yamaha memiliki kompetitor-kompetitor dari perusahaan lain seperti Honda dan Suzuki. Dalam konteks ini, sesama dealer Yamaha juga merupakan pesaing bagi PT. Yamaha Mataram Sakti. Selain itu, terdapat pula perubahan lingkungan dan minat konsumen yang membuat PT. Yamaha Mataram Sakti harus lebih sadar akan kebutuhan serta keinginan konsumen . Berikut merupakan analisa yang dilakukan peneliti sebagai dasar penelitian “ Analisis SWOT Sebagai Dasar Pemasaran Berdaya Saing “ (studi pada dealer Yamaha Mataram Sakti cabang jl. Orang Kayo Pingai no. 77 Jambi).

        RUMUSAN MASALAH

        Masalah yang dibahas dalam penelitian ini adalah :
        Bagaimana pengaruh faktor-faktor internal terhadap perusahaan ?
        Bagaimana pengaruh faktor-faktor eksternal terhadap perusahaan ?
        Bagaimana menentukan strategi pemasaran berdaya saing Yamaha Mataran Sakti menggunakan analisis SWOT ?

        TUJUAN dan MANFAAT PENELITIAN

        1.3.1. Tujuan Penelitian

        Menganalisis faktor internal dengan menggunakan SAP (Strategic Advantage Profile).
        Menganalisis faktor eksternal dengan menggunakan ETOP (Environmental Threat and Oppurtunity Profiles).
        Menentukan strategi perusahaan berdasarkam posisis bersaing dan jenis usaha perusahaan dengan menggunakan analisis SWOT.
        Menentukan strategi pemasaran yang paling tepat dan berdaya saing.

        1.3.2. Manfaat Penelitian

        Berkontribusi dalam bidang ilmu pemasaran khususnya pemasaran menggunakan analisis SWOT.
        Sebagai bahan pertimbangan bagi perusahaan dan evakuasi bagi perusahaan untuk menentukan strategi pemasaran yang berdaya saing.

        2.1. POPULASI dan SAMPEL
        2.1.1 POPULASI
        Populasi adalah kumpulan individu atau objek penelitian yang memiliki kualitas-kualitas serta ciri-ciri yang telah ditetapkan. Berdasarkan ciri-ciri tersebut, populasi dapat di pahami sebagai kelompok individu atau objek pengamatan yang minimal satu kesamaan karakteristik (Cooper dan Emery, 1995).
        Untuk penelitian ini digunakan adalah populasi dari pengguna sepeda motor merk Yamaha yang melakukan pembelian pada Yamaha Mataram Sakti di Jambi.
        2.1.2 SAMPEL
        Sampel adalah sebagian dari populasi yang memiliki karakteristik yang relatif sama dan dianggap mewakili populasi (Singarimbun, 1991, p.5). Desain pengambilan sampel menggunakan metode cluster sampling yaitu, sebuah sampel probilitas dimana sampel ditarik hanya dari salah satu kelompok saja (Cooper dan Emory, 1995). Dengan metode ini populasi dibagi terlebih dahulu menjadi kelompok-kelompok yang biasanya didasarkan pada lokasi geografik kemudian sampel ditarik secara random dari lokasi geografik tertentu saja yang disebut sebagai cluster group.
        Populasi sasaran dari penelitian ini adalah orang-orang yang telah membeli produk sepeda motor di Yamaha Mataram Sakti di Jambi. Dari data yang telah dihimpun jumlah populasi pengguna sepeda motor Yamaha pada Yamaha Mataram Sakti di kota Jambi ±250.000 orang yang tersebar di 11 kecamatan. Pada penelitian ini pembagian kelompok cluster berdasarkan kecamatan dengan jumlah pelanggan terbanyak dan sesuai dengan kerangka sampel, yaitu Kecamatan Jambi Timur, Jambi Selatan dan Telanai Pura. Adapun jumlah populasi kelompok cluster pengguna sepeda motor Yamaha Mataram Sakti di tiga Kecamatan tersebut adalah 95.000 pelanggan, dengan jumlah populasi untuk masing-masing Kecamatan dapat dilihat dari tabel 1.1 berikut ini :

        Tabel 1.1
        Data Populasi Pengguna Sepeda Motor Yamaha
        No. Kecamatan Pelanggan Persentase (%)
        1 Jambi Timur 31.727 33%
        2 Jambi Selatan 28.823 30%
        3 Telanai Pura 34.450 36%
        Total 95.000 100%

        Selanjutnya, penentuan jumlah sampel total ditentukan dengan menggunakan rumus dibawah ini :
        n=N/(1+N 〖(moe)〗^2 )
        Keterangan :
        n = jumlah sampel
        N = populasi
        moe = margin of error maksimal

        Dengan tingkat kesalahan maksimun (moe) 10% di dapat jumlah sampel yang akan diambil adalah:
        n=N/(1+N 〖(moe)〗^2 )
        n=95.000/(1+95.000〖(0,1)〗^2 )=99,89
        Maka jumlah sampel yang akan diambil menurut rumus ini adalah 100 responden sesuai dengan pembulatan keatas.
        Selain itu jumlah sampel total pada penelitian ini merujuk pula pada sampel minimal dengan menggunakan alat analisis SEM yaitu 100 – 200 sampel (Hair, Anderson, Tatham dan Black dalam Ferdinand, 2000, p.48). Menurut Hair, Anderson, Tatham dan Black (Ferdinand, 2000, p.48) pada suatu penelitian yang menggunakan teknik analisa SEM, mengharuskan bahwa sampel yang dianggap representatif untuk digunakan dalam penelitian adalah lima (5) sampai dengan sepuluh (10), dikalikan jumlah parameter yang diestimasikan. Dengan demikian sampel minimal untuk penelitian ini dengan jumlah parameter yang diestimasikan sebanyak 18 adalah: 5 x 18 = 90 responden atau digenapkan menjadi 100 sampel agar sesuai sampel minimal dengan alat analisis SEM.
        Sehingga didapat jumlah sampel dari masing-masing cluster, dengan mengalikan persentase dengan jumlah sampel (100) yaitu: Kecamatan Jambi Timur sebanyak 34 orang, Kecamatan Jambi Selatan sebanyak 30 orang dan Kecamatan Telanai Pura sebanyak 36 orang.
        Untuk menentukan individu yang menjadi responden adalah diambil secara acak dari populasi masing-masing kecamatan terpilih untuk pengambilan pertama. Lalu untuk pengambilan kedua dan seterusnya, diurutkan secara sistematik (seperti deret ukur) dari nomor yang ditentukan pertama secara random dengan menggunakan interval tertentu. Penentuan interval adalah sebagai berikut:
        ƒ Kecamatan Jambi Timur : 31.727/ 34 = 933
        ƒ Kecamatan Jambi Selatan : 28.823/ 30 = 960
        ƒ Kecamatan Telanai Pura : 34.450/ 36 = 956

        2.2 DAFTAR PUSTAKA

        Cooper, D.R. and Emory, C.W., 1995, Metode Penelitian Bisnis, jilid 1, edisi kelima, Penerbit Erlangga.
        Singarimbun, M., 1991, Metode Penelitian Survei, Edisi revisi, Penerbit LP3ES, Jakarta.
        Gronroos, C., 1994, “From the Marketing Mix to Relationship Marketing : Towards a Paradigm Shift in Marketing”, Journal of Managements Decisions, Vol. 32 No. 2

        Komentar oleh Fransisca yulianti | Januari 13, 2012

      • BAB I
        PENDAHULUAN
        LATAR BELAKANG MASALAH

        Perkembangan bisnis belakangan ini semakin menonjol akan persaingan, perubahan dan ketidakpastian. Keadaan ini menimbulkan persaingan yang sangat signifikan antar perusahaan yang bergerak di bidang yang sama, dikarenakan volume produk yang semakin meningkat, maupun bertambah pesatnya perkembangan teknologi. Hal ini memaksa perusahaan untuk lebih memperhatikan lingkungan yang dapat mempengaruhi perusahaan, agar perusahaan mengetahui pemasaran apa dan bagaimana yang harus diterapkan dalam perusahaannya. Oleh sebab itu, persaingan sangat penting bagi keberhasilan atau kegagalan suatu perusahaan (Porter, 1993), dimana pesaing yang menggunakan pendekatan pasar adalah perusahaan yang memuaskan kebutuhan pelanggan yang sama. Sehingga, perusahaan harus lebih cermat membaca dan mengamati keadaan pasar sehingga dapat menciptakan produk yang berkualitas, memberikan pelayanan yang berkualitas dan memuaskan konsumen agar dapat memenangkan persaingan.
        Menurut Andriansyah (2007), persaingan bisnis sesungguhnya adalah dimana layaknya seperti arena pertandingan, maka perusahaan menggunakan berbagai jurus-jurus “sakti dan pamungkas” agar bisa segera “menjatuhkan” lawan. Dalam konteks ini, sedikit saja perusahaan melakukan kesalahan dalam pengambilan keputusan bisnis dapat berdampak pada merosotnya penjualan produk yang ditawarkan perusahaan terhadap produk kompetitor, begitu pula sebaliknya.
        Perusahaan perlu mengenali kekuatan dan kelemahan perusahaan dalam persaingan. Hal ini sangat membantu perusahaan dalam mengenali diri serta memanfaatkan peluang yang ada dan menghindari atau meminimalkan ancaman. Pernyataan ini juga di ungkapkan oleh Guiltinan (1994), dimana dalam menentukan strategi bersaing dan mengambil keputusan seorang manajer harus mengenali apa kelemahan, kekuatan, peluang, ancaman yang dimiliki perusahaan serta mengenali keunggulan pesaing yang mungkin di miliki.
        Perusahaan mau tidak mau dituntut untuk selalu melakukan inovasi dalam strategi bersaing. Dimana strategi bersaiang merupakan upaya mencari posisi bersaing yang menguntungkan dalam suatu industri atau arena fundamental dimana persaingan berlangsung. Selain itu teori pemasaran modern menyatakan bahwa kunci sukses sebuah perusahaan bersaing tergantung pada penyasuaian secara dinamis terhadap lingkungan yang kompleks dan berubah-ubah.
        Suatu perusahaan dapat mengembangkan strategi bersaing dengan cara mencari kesesuaian antara kekuatan internal dan kekuatan eksternal perusahaan tersebut. Pentingnya strategi adalah alat untuk mencapai tujuan perusahaan dalam jangka panjang dan terus-menerus dilakukan berdasarkan sudut pandang tentang apa yang dihadapi oleh para pesaing dimasa depan untuk mencapai keunggulan bersaing. Pentingnya perusahaan mengetahui faktor-faktor kunci sukses internal dan internal dalam lingkungan perusahaan merupakan nilai lebih untuk daya saing perusahaan itu sendiri dalam menghadapi pesaing mereka.

        Faktor-faktor lingkungan perusahaan sangat penting bagi manajer atau manajemen puncak adalah:
        Bahwa perusahaan tidak berdiri sendiri melainkan berinteraksi dengan lingkungan dalam perusahaan itu sendiri.
        Pengaruh lingkungan sangatlah kompleks dan dapat mempengaruhi masing-masing bagian pada tiap bagian perusahaan.Pemasaran seperti halnya dengan ilmu pengetahuan bersifat dindamis dan selalu mengalami perunbahan. Perubahan dalam dunia pemasaaran merupakan suatu keharusan karena, dunia bisnis sebagai induk dari pemasaran terus-menerus berubah menyesuaikan diri dengan kemajuan jaman (Gusnur, 2008). Pemasaran di suatu perusahaan, selain bertindak dinamis juga harus selalu menerapkan prinsip-prinsip unggul dimana perusahaan harus meninggalkan kebiasaan yang lama yang sudah tidak berlaku para era sekarang. Pada era sekarang produsen tidak dapat memaksakan kehendak terhadap pembelian produk konsumen.
        Hal ini juga terjadi pada PT. Yamaha Mataram Sakti di Jambi, Mataram Sakti merupakan sebuah dealer resmi sepeda motor yamaha yang berkantor pusat di Jambi. Selain menjadi dealer asli yamaha, PT. Yamaha Mataram Sakti memberikan pelayanan lain seperti showroom, bengkel, service, dan menyediakan suku cadang bagi sepeda motor yamaha. Dibidang penjualan, yamaha memiliki kompetitor-kompetitor dari perusahaan lain seperti Honda dan Suzuki. Dalam konteks ini, sesama dealer Yamaha juga merupakan pesaing bagi PT. Yamaha Mataram Sakti. Selain itu, terdapat pula perubahan lingkungan dan minat konsumen yang membuat PT. Yamaha Mataram Sakti harus lebih sadar akan kebutuhan serta keinginan konsumen . Berikut merupakan analisa yang dilakukan peneliti sebagai dasar penelitian “ Analisis SWOT Sebagai Dasar Pemasaran Berdaya Saing “ (studi pada dealer Yamaha Mataram Sakti cabang jl. Orang Kayo Pingai no. 77 Jambi).

        RUMUSAN MASALAH

        Masalah yang dibahas dalam penelitian ini adalah :
        Bagaimana pengaruh faktor-faktor internal terhadap perusahaan ?
        Bagaimana pengaruh faktor-faktor eksternal terhadap perusahaan ?
        Bagaimana menentukan strategi pemasaran berdaya saing Yamaha Mataran Sakti menggunakan analisis SWOT ?

        TUJUAN dan MANFAAT PENELITIAN

        1.3.1. Tujuan Penelitian

        Menganalisis faktor internal dengan menggunakan SAP (Strategic Advantage Profile).
        Menganalisis faktor eksternal dengan menggunakan ETOP (Environmental Threat and Oppurtunity Profiles).
        Menentukan strategi perusahaan berdasarkam posisis bersaing dan jenis usaha perusahaan dengan menggunakan analisis SWOT.
        Menentukan strategi pemasaran yang paling tepat dan berdaya saing.

        1.3.2. Manfaat Penelitian

        Berkontribusi dalam bidang ilmu pemasaran khususnya pemasaran menggunakan analisis SWOT.
        Sebagai bahan pertimbangan bagi perusahaan dan evakuasi bagi perusahaan untuk menentukan strategi pemasaran yang berdaya saing.

        2.1. POPULASI dan SAMPEL
        2.1.1 POPULASI
        Populasi adalah kumpulan individu atau objek penelitian yang memiliki kualitas-kualitas serta ciri-ciri yang telah ditetapkan. Berdasarkan ciri-ciri tersebut, populasi dapat di pahami sebagai kelompok individu atau objek pengamatan yang minimal satu kesamaan karakteristik (Cooper dan Emery, 1995).
        Untuk penelitian ini digunakan adalah populasi dari pengguna sepeda motor merk Yamaha yang melakukan pembelian pada Yamaha Mataram Sakti di Jambi.
        2.1.2 SAMPEL
        Sampel adalah sebagian dari populasi yang memiliki karakteristik yang relatif sama dan dianggap mewakili populasi (Singarimbun, 1991, p.5). Desain pengambilan sampel menggunakan metode cluster sampling yaitu, sebuah sampel probilitas dimana sampel ditarik hanya dari salah satu kelompok saja (Cooper dan Emory, 1995). Dengan metode ini populasi dibagi terlebih dahulu menjadi kelompok-kelompok yang biasanya didasarkan pada lokasi geografik kemudian sampel ditarik secara random dari lokasi geografik tertentu saja yang disebut sebagai cluster group.
        Populasi sasaran dari penelitian ini adalah orang-orang yang telah membeli produk sepeda motor di Yamaha Mataram Sakti di Jambi. Dari data yang telah dihimpun jumlah populasi pengguna sepeda motor Yamaha pada Yamaha Mataram Sakti di kota Jambi ±250.000 orang yang tersebar di 11 kecamatan. Pada penelitian ini pembagian kelompok cluster berdasarkan kecamatan dengan jumlah pelanggan terbanyak dan sesuai dengan kerangka sampel, yaitu Kecamatan Jambi Timur, Jambi Selatan dan Telanai Pura. Adapun jumlah populasi kelompok cluster pengguna sepeda motor Yamaha Mataram Sakti di tiga Kecamatan tersebut adalah 95.000 pelanggan, dengan jumlah populasi untuk masing-masing Kecamatan dapat dilihat dari tabel 1.1 berikut ini :

        Tabel 1.1
        Data Populasi Pengguna Sepeda Motor Yamaha
        No. Kecamatan Pelanggan Persentase (%)
        1 Jambi Timur 31.727 33%
        2 Jambi Selatan 28.823 30%
        3 Telanai Pura 34.450 36%
        Total 95.000 100%

        Selanjutnya, penentuan jumlah sampel total ditentukan dengan menggunakan rumus dibawah ini :
        n=N/(1+N 〖(moe)〗^2 )
        Keterangan :
        n = jumlah sampel
        N = populasi
        moe = margin of error maksimal

        Dengan tingkat kesalahan maksimun (moe) 10% di dapat jumlah sampel yang akan diambil adalah:
        n=N/(1+N 〖(moe)〗^2 )
        n=95.000/(1+95.000〖(0,1)〗^2 )=99,89
        Maka jumlah sampel yang akan diambil menurut rumus ini adalah 100 responden sesuai dengan pembulatan keatas.
        Selain itu jumlah sampel total pada penelitian ini merujuk pula pada sampel minimal dengan menggunakan alat analisis SEM yaitu 100 – 200 sampel (Hair, Anderson, Tatham dan Black dalam Ferdinand, 2000, p.48). Menurut Hair, Anderson, Tatham dan Black (Ferdinand, 2000, p.48) pada suatu penelitian yang menggunakan teknik analisa SEM, mengharuskan bahwa sampel yang dianggap representatif untuk digunakan dalam penelitian adalah lima (5) sampai dengan sepuluh (10), dikalikan jumlah parameter yang diestimasikan. Dengan demikian sampel minimal untuk penelitian ini dengan jumlah parameter yang diestimasikan sebanyak 18 adalah: 5 x 18 = 90 responden atau digenapkan menjadi 100 sampel agar sesuai sampel minimal dengan alat analisis SEM.
        Sehingga didapat jumlah sampel dari masing-masing cluster, dengan mengalikan persentase dengan jumlah sampel (100) yaitu: Kecamatan Jambi Timur sebanyak 34 orang, Kecamatan Jambi Selatan sebanyak 30 orang dan Kecamatan Telanai Pura sebanyak 36 orang.
        Untuk menentukan individu yang menjadi responden adalah diambil secara acak dari populasi masing-masing kecamatan terpilih untuk pengambilan pertama. Lalu untuk pengambilan kedua dan seterusnya, diurutkan secara sistematik (seperti deret ukur) dari nomor yang ditentukan pertama secara random dengan menggunakan interval tertentu. Penentuan interval adalah sebagai berikut:
        ƒ Kecamatan Jambi Timur : 31.727/ 34 = 933
        ƒ Kecamatan Jambi Selatan : 28.823/ 30 = 960
        ƒ Kecamatan Telanai Pura : 34.450/ 36 = 956

        2.2 DAFTAR PUSTAKA

        Cooper, D.R. and Emory, C.W., 1995, Metode Penelitian Bisnis, jilid 1, edisi kelima, Penerbit Erlangga.
        Singarimbun, M., 1991, Metode Penelitian Survei, Edisi revisi, Penerbit LP3ES, Jakarta.
        Gronroos, C., 1994, “From the Marketing Mix to Relationship Marketing : Towards a Paradigm Shift in Marketing”, Journal of Managements Decisions, Vol. 32 No. 2

        Populasi seperti di atas itu arti, bukan populasi penelitian anda.

        Komentar oleh fransisca yulianti | Januari 13, 2012

  6. Tugas Individu
    Nama: Mariaty Sitompul
    Nim : C1B009015
    MGT ‘A’

    Judul : Analisis pengaruh perubahan merek/brand terhadap tingkat penjualan pada Novita Hotel Jambi.

    Kita sama-sama mengetahui bahwa Novohotel Jambi berubah menjadi Novita. Kalau judulnya melihat perubahan merek maka harus dapat membandingkan antara orang yg pernah menggunakan Novohotel dan Novita. Sampel seperti ini susah mencarinya. Kalau hendak meneliti merek, untuk kasus lain juga boleh karena judulmu ini di lapangan susah mencari sampel. Berjuang lagi.

    Komentar oleh Mariaty Sitompul | Desember 7, 2011 | Balas

  7. TUGAS I INDIVIDU
    NAMA : SULASTRY WULANDARY
    NIM : C1B009045
    KELAS : MGT A 2009

    “PENGARUH STRATEGI PEMASARAN SWALAYAN PADA TINGKAT KONSUMSI KONSUMEN DI WAKTU TERTENTU”

    Komentar oleh wulan16 | Desember 7, 2011 | Balas

    • maaf pak, saya tidak melihat komentar judul proposal saya, berikut saya kirimkan lagi dengan latar belakangnya pak, terimakasih

      “PENGARUH STRATEGI PEMASARAN SWALAYAN PADA TINGKAT KONSUMSI KONSUMEN DI WAKTU TERTENTU”

      1. Latar Belakang Masalah
      Seiring dengan perkembangan ekonomi yang mempunyai beragam aktivitas pemasaran dan kebudayaan yang ada pada masyarakat membawa dampak pada pola perilaku belanja konsumen, maka tuntutan akan tempat berbelanja yang nyaman dan dapat menyediakan segala kebutuhan konsumen dalam satu swalayan semakin dibutuhkan.
      Perkembangan swalayan dan tingkat konsumsi konsumen yang terus berlangsung hendaknya dapat disadari oleh para wirausaha untuk dijadikan peluang, dengan memperhatikan pola perilaku konsumsi konsumen pada kebudayaan yang telah ada dan mengimplementasikannya terhadap strategi pemasaran dengan menawarkan pelayanan dan harga harga yang varian sehingga menarik minat konsumen untuk membeli khususnya pada waktu-waktu tertentu yang sudah menjadi bagian dari kebudayaan masyarakat sekitar seperti pada hari-hari besar idul fitri, natal.
      Mengenali pola konsumtif konsumen sangatlah menguntungkan bagi swalayan untuk dapat tetap bersaing dan survive (kelangsungan hidup perusahaan). Dengan melihat keterkaitan antara tingkat konsumsi konsumen pada saat tertentu akan menjadi sangat efektif bila menjadikannya peluang dan dihubungkan dengan kegiatan pemasaran, pastinya dengan menyadari dan memahami kebudayaan tersebut dan pola konsumsi masyarakat di waktu sebelumnya.
      Strategi pemasaran hendaknya dilakukan dengan perhitungan dan pertimbangan yang tepat sehingga tidak ada pemborosan biaya baik itu dalam operasional maupun dalam biaya promosi maupun iklan dan efektifitas yang dimaksud ialah pemilihan stategi pemasaran yang tepat dan sesuai dengan keadaan pasar sehingga sasaran yang ditetapkan dapat tercapai, penelitian ini akan difokuskan kepada keterkaitan konsumsi konsumen terhadap waktu tertentu dan bagaimana menjadikannya sebagai peluang dalam mendapatkan laba di suatu swalayan dengan menggunakan strategi pemasaran.

      Anda boleh lanjutkan, tapi perlu diptertegas strategi pemasaran dimaksud misalnya pemberian diskon, penataan barang, lahanparkir dll. Sehingga terhindar dari konsep yg terla luluas.

      Komentar oleh wulan16 | Desember 15, 2011 | Balas

      • terimakasih pak, iya nanti akan saya diperjelas lagi pada rumusan masalah

        Komentar oleh wulan16 | Desember 19, 2011

      • 85.Pak, ada sedikit perubahan judul, agar lebih signifikan saya ganti dengan
        “PENGARUH STRATEGI PEMASARAN SWALAYAN KEMBANG TURI AGUNG PADA TINGKAT KONSUMSI KONSUMEN DI WAKTU TERTENTU”

        dan dengan latar belakang penjelasan strategi pemasaran yang sudah bapak sarankan

        1.1 Latar Belakang Masalah
        Seiring dengan perkembangan ekonomi yang mempunyai beragam aktivitas pemasaran dan kebudayaan yang ada pada masyarakat membawa dampak pada pola perilaku belanja konsumen, maka tuntutan akan tempat berbelanja yang nyaman dan dapat menyediakan segala kebutuhan konsumen dalam satu swalayan semakin dibutuhkan.
        Perkembangan swalayan dan tingkat konsumsi konsumen yang terus berlangsung hendaknya dapat disadari oleh para wirausaha untuk dijadikan peluang, dengan memperhatikan pola perilaku konsumsi konsumen pada kebudayaan yang telah ada dan mengimplementasikannya terhadap strategi pemasaran dengan menawarkan pelayanan dan harga harga yang varian sehingga menarik minat konsumen untuk membeli khususnya pada waktu-waktu tertentu yang sudah menjadi bagian dari kebudayaan masyarakat sekitar seperti pada hari-hari besar idul fitri, natal.
        Mengenali pola konsumtif konsumen sangatlah menguntungkan bagi swalayan untuk dapat tetap bersaing dan survive (kelangsungan hidup perusahaan). Dengan melihat keterkaitan antara tingkat konsumsi konsumen pada saat tertentu akan menjadi sangat efektif bila menjadikannya peluang dan dihubungkan dengan kegiatan pemasaran, pastinya dengan menyadari dan memahami kebudayaan tersebut dan pola konsumsi masyarakat di waktu sebelumnya.
        Strategi pemasaran hendaknya dilakukan dengan perhitungan dan pertimbangan yang tepat sehingga tidak ada pemborosan biaya baik itu dalam operasional maupun dalam biaya promosi atau iklan dan efektifitas yang dimaksud ialah pemilihan stategi pemasaran yang tepat dan sesuai dengan keadaan pasar sehingga sasaran yang ditetapkan dapat tercapai, seperti pada swalayan penelitian ini akan difokuskan kepada strategi pemasaran dengan kelengkapan berbagai macam barang dan penataan barang yang kemudian akan mempengaruhi konsumsi konsumen terhadap waktu tertentu.

        Komentar oleh wulan16 | Januari 4, 2012

  8. TUGAS I (INDIVIDU)
    NAMA : AYU PRATIWI
    NIM. : C1B008055
    MGT B 08

    JUDUL : Analisis Kepuasan Pelanggan Dalam Melakukan Keputusan Pembelian produk “indofood” di Jambi.

    PRoduk indofood banyak, lantas yg mana hendak dipilih?

    Komentar oleh Ayu Pratiwi | Desember 8, 2011 | Balas

    • pak jo saya ganti jadi ” analisis perilaku konsumen dalam memutuskan membeli produk mie instan merek indofood “

      Komentar oleh ayu pratiwi | Januari 10, 2012 | Balas

  9. Tugas Individu :
    Mariaty Sitompul
    C1B009015
    Mgt A 2009

    Judul : Analisis pengaruh perubahan nama produk/merek terhadap tingkat penjualan pada Novita Hotel Jambi

    Pekerjaan ini agak sulit dilakukan, karena sulit menemukan pelanggan Novotel, karena merek ini telah tidak ada. Sementara anda melihat perubahan Novotel menjadi Novita Hotel, saya kira perlu dicampkan lagi mana yg lebih baik untuk anda.

    Komentar oleh Mariaty Sitompul | Desember 8, 2011 | Balas

  10. Tugas I (INDIVIDU)
    NAMA : IKHSANI ARIFIN SAMOSIR
    NIM : C1B009047
    MGT A

    JUDUL : “Analisis Persepsi Mahasiswa Porkes Unja Terhadap Produk Motor Yamaha Vixion”

    Ikhsan, judul seperti ini terlalu banyak di FE. Silahkan temukan judul lain.

    Komentar oleh Ikhsani arifin samosir | Desember 8, 2011 | Balas

    • Pak , bagaimana dengan ” Ananlisis Pengaruh Kelompok terhadap pembelian produk Motor Yamaha Vixion terhadap Mahasiswa Porkes Unja” ???

      Judul ini ada perbaikan, misalnya dg mencari kelompok referensi. Tapi harus dapat ditentukan siapa kelompok referensi dan lebih dari itu, apakah pembelian motor juga menggunakan kelompok referensi. Untuk barang yg harga dan penggunaannya kompleks mugkin kelompok referensi menjadi acuan. Misalnya, mobil, notebook dll.

      Komentar oleh Ikhsani Arifin Samosir | Desember 19, 2011 | Balas

      • kalau kelompok belajar dan komunitas pak apakah bisa sebagai kelompok referensi???? karena yang akan saya amati adalah kelompok mahasiswa dan komunitas pengguna motor tersebut, karena saya pikir kebanyakan pembelian yang dilakukan oleh kelompok ini bukan berdasar manfaat utilitarian, melainkan atas manfaat Hedonik pak.

        Komentar oleh Ikhsani Arifin Samosir | Desember 21, 2011

      • BAB I
        Pendahuluan

        1.1 Latar Belakang

        Dengan semakin berkembangnya teknologi dan ilmu pengetahuan semakin banyak produk-produk yang dapat di haslikan oleh berbagai perusahaan-perusahaan dalam pengembangan dan inovasi produknya. Salah satu sektor yang menagalami perkembangan pesat adalah otomotif. perkembangan pesat yang dialami perusahaan-perusahaan otomotif seperti kenderaan motor yang ada saat ini telah menciptakan banyak produk kenderaan bermotor yang bervariasi, mulai dari kenderaan yang didesain sederhana dan hemat bahan bakar sampai desain yang sporty. Pada dasarnya kenderaan bermotor adalah kenderaan yang digerakkan oleh peralatan teknik untuk menggerakkannya dan digunakan untuk transportasi darat. Motor merupakan salah satu kenderaan modern yang saat ini banyak digunakan oleh manusia untuk pemenuhan kebutuhan transportasi pribadi dalam menjalankan aktifitas mereka dan merupakan kenderaan yang mudah dalam penggunaannya. Motor memiliki ukuran yang lebih ramping dibanding kenderaan lainnya dan kapasitas penumpang hanya 2 orang. Selain itu motor merupakan kenderaan yang murah dalam konsumsi bahan bakar dan perawatan dibanding kenderaan lain.
        Saat ini ada tiga jenis produk motor yaitu motor bebek, matic dan Sport. Perbedaan produk ini terletak pada desainnya, model rangka utama,serta jenis mesin dan kapasitas cc yang digunakan kenderaan. Di Indonesia jenis motor bebek merupakan produk yang lebih unggul dalam pasarnya pada tahun 1980, contohnya adalah motor Honda 70 merupakan produk yang menjadi leader dalam pasarnya dan kemudian diikuti oleh Suzuki Jet Cooled. Motor-motor tersebut merupakan kenderaan bermotor yang banyak digunakan walau modelnya sederhana. Pada tahun yang sama Kenderaan motor sport juga telah beredar di pasaran namun minat pembelian terhadap motor sport tersebut masih kecil. Hal tersebut diakibatkan asupan bahan bakar kenderaan yang lebih boros dibandingkan kenderaan bermotor jenis bebek. Selain itu adanya persepsi jelek masyarakat terhadap motor sport yang dianggap sebagai kenderaan pelaku kriminal seperti perampok. Hal tersebut mendorong kurangnya minat masyarakat terhadap produk tersebut.
        Setelah krisis pada tahun 1998 produk motor sport semakin banyak di pasar walau minat konsumen terhadap produk tersebut masih kecil. Banyaknya tawaran dan harga yang bersaing mulai merubah pandangan konsumen terhadap produk motor sport di Indonesia. Adanya pergeseran persepsi terhadap produk tersebut mulai meningkatkan minat konsumen dalam membeli produk motor sport. Persaingan yang ketat membuat pengusaha semakin cekatatan dalam mengembangkan produk. Seiring perkembangan teknologi dan pola pikir masyarakat mengakibatkan adanya pergeseran nilai dalam masyarakat yang berpengaruh terhadap prilaku konsumsi.
        Saat ini produk motor sport semakin digemari dan dianggap unik oleh penggunakenderaan bermotor. Merek-merek produk motor yang ditawarkan juga semakin banyak seperti Honda CBR, Honda Tiger, Honda Mega Pro, Suzuki Thunder, Kawasaki Ninja,Yamaha Byson, Yamaha R5, dan Yamaha Vixion. Masing-masing merek motor tersebut berusaha membuat produknya lebih unggul dibanding merek lain. Maka kegiatan Pemasaran yang baik dan tepat yang memegang peranan yang penting dalam menunjang kelangsungan usaha dan perkembangan perusahaan. Produsen harus mampu meraih hati konsumennya terhadap hasil produksi yang dujual ke pasar demi memuaskan kebutuhan konsumen.

        Dalam memahami perilaku konsumen tentu tidak mudah karena konsumen mempunyai sifat yang berbeda-beda sebagaimana dari kebutuhan manusia yang tidak terbatas disamping dipengaruhi oleh kondisi eksternal dan internal lainnya yang berakibat langsung terhadap perilaku konsumen. Faktor eksternal yang dimaksud meliputi kebudayaan, sub budaya,kelas sosial,kelompok sosial, kelompok referensi, dan keluarga. Sedangkan faktor internal adalah faktor yang ada pada diri konsumen itu sendiri (psikologis) yang meliputi: belajar, kepribadian, dan konsep diri, serta sikap, Stanton1996:155).
        Banyaknya kenderaan bermotor yang dihasilkan akan oleh berbagai perusahaan mengakibatkan konsumen semakin selektif terhadap produk motor yang akan mereka beli. Tindakan selektif ini salah satunya ditunjukkan oleh perilaku konsumen yang membutuhkan pertimbangan dalam mengambil keputusannya. Kelompok acuan yang terdiri dua orang atau lebih, yang dijadikan sebagai dasar pertimbangan, yang akan membentuk sikap umum atau khusus, atau pedoman khusus bagi perilaku, termasuk di dalamnya pedoman dalam memutuskan pembelian. Semakin kuat pengaruh kelompok terhadap individu akan semakin kuat perngaruhnya dalam keputusan pembelian. Pengaruh kelompok referensi juga sangat berpengaruh terhadap perilaku konsumen dalam keputusan pembelian. Seorang yang ingin bergabung menjadi anggota komunitas Yamaholigan akan membeli produk yamaha.

        Komentar oleh Ikhsani Arifin Samosir | Januari 14, 2012

      • Pada kalangan Mahasiswa Porkes Unja terlihat jelas bahwa sepeda motor sport seperti Yamaha vixion banyak digunakan oleh kelompok tersebut. Hal tersebut menunjukkan adanya perubahan persepsi terhadap motor tersebut. Motor Yamaha Vixion merupakan kenderaan yang sporty dan desain yang lebih menarik perhatian terhadap produk tersebut. Faktor-faktor eksternal sangat berpengaruh terhadap minat mahasiswa porkes Unja untuk membeli kenderaan tersebut dimana kebanyakan mahasiwa dalam kampus membentuk kelompok-kelompok yang menunjukkan kesamaan dan sikap mereka. Pengaruh kelompok sangat besar dalam penntuan keputusan pembelian produk tersebut. Berdasarkan latar belakang di atas penulis bertujuan mengadakan penelitian terhadap” pengaruh Kelompok Referensi Pada Mahasiswa Porkes Unja”.

        1.2 Rumusan Masalah
        Berdasarkan uraian di atas maka dapat diidentifikasikan beberapa masalah sebagai berikut:
        1.2.1 Bagaimana Pengaruh Kelompok referensi terhadap mahasiswa pokes unjadalam menagmbil keputusan pembelian Motor Yamaha Vixion?
        1.2.2 Seberapa Besar Peranan Kelompok Dalam mengubah persepsi anggota kelompoknya terhadap produk motor tesebut?
        1.2.3 Bagaiamana perusahaan menyikapi pengaruh kelompok tersebut terhadap keputusan pembelian produk mereka?

        1.3 Tujuan Penelitian
        Berdasarkan permasalahan di atas, Tujuan yang hendak dicapai dalam penelitian ini adalah sebagai berikut:
        1.3.1 Untuk mengetahui besar pengaruh kelompok referensi pada mahasiwa porkes dalam pengambilan keputusan pembelian motor Yamaha Vixion
        1.3.2 untuk mengetahui peranan kelompok dalam mengubah persepsi anggotanya terhadap produk motor tersebut
        1.3.3 Untuk mengetahui respon perusahaan terhadap pengaruh kelompok dalam keputusan pembelian produk mereka

        1.4 Manfaat Penelitian
        Manfaat yang dapat diperoleh dari penelitian ini dapat berupa manfaat teoritis dan manfaat praktis
        1.4.1 Manfaat teoritis
        1. Penelitian ini diharapkan dapat memberikan sumbangan yang berharga bagi perkembangan ilmu pengetahuan terutama dengan yang berkaitan dengan ilmu pemasaran dan lingkup promosi dalam pengambilan keputusan konsumen berdasar pengaruh kelompok referensi
        2. Dapat memberikan wawasan kepada pembaca tenteng besarnya pengaruh kelompok terhadap keputusan pembelian produk
        3. Hasil penelitian ini diharapkan dapat menjadi referensi sehingga dapat dibaca
        1.4.2 Manfaat Praktis dari penelitian
        1. Sebagai bahan pembanding studi mendatang
        2. Memberikan informasi bagi perusahaan dan masyarakat setempat untuk mengetahui bagaimana pengaruh kelompok terhadap perilaku mahasiswa porkes unja dalam mengambil keputusan pembelian motor yamaha vixion.

        1.5 Metode Penelitian
        1.5.1 Metode penelitian kuantitatif adalah metode tradisional yang sudah cukup lama. Metode ini disebut sebagai metode positivistik karena berdasarka filasafat positivisme. Metode ini juga disebut sebagi metode discovery, karena dengan metode ini dapat ditemukan dan dikembangkan berbagai ilmu pengetahuan dan teknologi baru.

        Ikhsan, tentukan dulu wilayah yg akan diteliti. Misalnya di FE, maka berikutnya ditentukan angkatan berapa, dari angkatan ini ditentukan bagaimana memilihnya.

        Komentar oleh Ikhsani Arifin Samosir | Januari 15, 2012

      • pak, bagaimana penentuan sampel dan populasi pada kasus tersebut???
        Mohon saran dan koreksi nya pak..!!!

        Komentar oleh Ikhsani Arifin Samosir | Januari 15, 2012

      • Terimakasih atas info nya pak, akan saya lengkapi lagi batasan wilayahnya.

        Komentar oleh Ikhsani Arifin Samosir | Januari 15, 2012

      • BAB II

        Tinjauan Pustaka

        2.1 Landasan Teori
        2.1.1 Pengertian Pemasaran
        Sehubungan dengan permasalahan yang terdapat dalam penelitian ini maka diperlukan adanya teori-teori atau konsep konsep yang memerlukan penjelasan. Dalam banyak perusahaan sekarang ini, Pemasaran memegang peranan penting sebagai suatu faktor penting untuk tetap bertahan menjalankan usahanya. Pemasaran merupakan faktor vital sebagai strategi perusahaan dalam menjalankan usahanya. Kata pemasaran sendiri berasal dari kata pasar, juga diartikan dengan mekanisme yang mempertemukan permintaan dan penawaran. Menurut kotler (2002:9) “Pemasaran adalah proses sosial yang didalamnya individu dan kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produk yang bernilai dengan pihak lain”.
        Menurut Stanton (1996:6)”Pemasaran adalah suatu sistem keseluruhan dari kegiatan-kegiatan usaha yang ditujukan untuk merencanakan, menentukan harga, mempromosikan, mendistribusikan barang dan jasa yang dapat memuaskan kebutuhan baik kepada pembeli yang ada maupun potensial.
        Menurut Lamb, Hair, (2001:6)”Pemasaran adalah suatu proses perencanaan dan menjalankan konsep, harga, promosi, dan sejumlah ide, barang dan jasa untuk menciptakan pertukaran yang mampu memuaskan tujuan individu dan organisasi.
        Berdasarkan ketiga defenisi di atas dapat disimpulkan bahwa pada dasarnya pemasaran buka hanya kegiatan menjual barang maupun jasa tetapi juga meliputi kegiatan untuk memenuhi kebutuhan dengan berusaha mempengaruhi konsumen untuk bersedia membeli barang dan jasa perusahaan melalui penciptaan, penawaran, dan pertukaran produk yang bernilai. Hal ini sangat perlu bagi manajer pemasaran untuk memahami tingkah laku konsumennya tersebut., Sehingga perusahaan dapat mengembangkan, menentukan harga, mempromosikan, dan mendistribusikan produk secara lebih baik. Manajer perlu memahami pengaruh kelompok sebagai salah satu fakto yang mempengaruhi konsumen dalam mengambil keputusan pembelian sehingga manajer mengetahui akan kesempatan, mngidentifikasi, serta menentukan segmentasi pasar secara tepat dan akurat.

        2.1.2 Perilaku Konsumen
        Menurut Swashta Dharmmesta perilaku konsumen adalah kegiatan-kegiatan individu yang secara langsung terlibat dalam mendapatkan dan mempergunakan barang-barang dan jasa-jasa, termasuk didalamya proses pengambilan keputusan pada persiapan dan penentuan kegiatan-kegiatan tersebut.
        Menurut Peter J. Paul dan jerry C. Olson (2000:6)” Perilaku konsumen merupakan interaksi dinamis antara pengaruh dan kondisi perilaku dan kejadian di sekitar lingkungan di mana manusia melakukan aspek pertukaran dalam kehidupan mereka.
        Dari defenisi di atas dua hal penting dari perilaku konsumen adalah proses pengambilan keputusan dan kegiatan fisik yang semuanya ini melibatkan individu dalam menilai, mendapatkan dan memeprgunakan barang-barang dan jasa secara ekonomi. Dengan kata lain perilaku konsumen adalah ilmu yang mempelajari dalam tindakan-tindakan yang dilakukan untuk membeli suatu barang atau jasa tertentu.

        2.1.3 Kelompok merupakan salah satu faktor yang mempengaruhi Perilaku pembelian konsumen
        Pada umumnya Konsumen sering meminta pendapat dari orang sekitar dan lingkungannya tentang produk apa yang harus dibeli.kelompok tersebut terdiri dari: Kelompok yang berhubungan langsung, kelompok primer dan sekunder, Kelompok formal dan informal, dan kelompok referensi.
        Kelompok yang berhubungan langsung adalah kelompok yang saling mengenal secara erat, seperti keluarga, teman dekat, tetangga, kawan sekerja, dan sebagainya, keanggotaan untuk sebagian besar dipengaruhi oleh jabatannya, tempat kediaman, dan usia. Kelompok ini mempunyai pengaruh langsung terhadap pendapat dan selera seseorang. Kelompok primer dan sekunder yaitu: kelompok-kelompok yang ditandai dengan ciri-ciri adanya saling mengenal antara anggota-anggota serta kerja sama erat yang bersifat pribadi. Termasuk dalam kelompok primer adalah keluarga,teman dekat, kolega, yang selalu melibatkan individu berinteraksi secara langsung terus-menerus dengan anggota lainya.
        kelompok formal adalah kelompok-kelompok yang mempunyai peraturan-peraturan yang tegas dan sengaja diciptakan untuk mengatur hubungan antar anggota-anggotanya. Misalnya peraturan-peraturan untuk memilih pimpinan, iuran dan sebagainya. Kelompok formal tidak mempunyai struktur organisasi yang tertentu. Kelompok-kelompok tersebut biasanya terbentuk karena pertemuan-pertemuan yang berulang kali. contohnya klub-klub olah raga, dan kelompok-kelompok kecil lainnya.
        Kelompok Referensi yaitu kelompok yang menjadi ukuran seseorang (bukan anggota kelompok tersebut) untuk membentuk kepribadian dan perilakunya. Dengan kata lain merupakan kelompok dalam mana orang ingin menjadi anggota atau dengan mana orang mengidentifikasikan dirinya.contohnya seseorang yang ingin jadi mahasiswa namun gagal menjadi mahasiswa akan berperilaku sebagai mahasiswa.

        Bab III

        Metode Penelitian
        3.1 Populasi
        Populasi adalah wilayah generalisasi yang terdiri atas : objek/subjek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulannya. Populasi bukan hanya orang, tetapi juga objek dan benda-benda alam yang lain. Populasi juga bukan sekedar jumlah yang ada pada objek/subjek yang dipelajari, tetapi meliputi seluruh karateristik/ sifat yang dimiliiki subjek/objek tersebut (Sugiono, 2010, hal 115).
        Populasi dalam penelitian ini adalah seluruh mahasiswa porkes UNJA yang membeli serta menggunakan motor Yamaha Vixion

        3.2 Sampel
        Sampel adalah bagian dari jumlah karakteristik yang dimiliki oleh populasi tersebut. Bila populasi besar, dan peneliti tidak mungkin meneliti semua yang ada pada populasi besar, dan meneliti tidak mungkin mempelajari semua sampel yang ada pada populasi.
        Karena banyaknya populasi lebih dari 100 maka jumlah sampel yang akan diambil sebanyak 50 responden yang terdapat dalam populasi tersebut. Dimana dari 50 sampel 20 responden dari angkatan 2009, 15 responden dari angkatan 2010, dan 15 responden dari angkatan 2011.

        Daftar Pustaka
        Basu Swastha Dharmmesta 2011 Analisis Perilaku Konsumen: Bpfe

        Sugiono. 2010. Metode Penelitian Bisnis. Malang: Alfabeta

        Kotler, philip. 2005. Manajemen Pemasaran. Jakarta: Indeks

        Setiadi, J. Nugroho. 2003. Perilaku Konsumen. Jakarta: Prenada Media

        Enggel, Blackwell, Miniard. 1994. Perilaku Konsumen (terjemahan). Jakarta: Binarupa Aksara

        Engel, James F.Blackwell, Roger D dan Miniard. 1992. Consumer Behavior. Chicago: The Dryden Pers

        Komentar oleh Ikhsani Arifin Samosir | Januari 22, 2012

  11. TUGAS INDIVIDU
    NAMA : MARIATY SITOMPUL
    NIM : C1B009015
    MGT A 09

    JUDUL : “Analisis Pengaruh Perubahan Brand/Merk Terhadap Tingkat Penjualan Pada Novita Hotel Jambi”

    Komentar oleh Mariaty Sitompul | Desember 8, 2011 | Balas

  12. TUGAS 1 ( INDIVIDU)
    NAMA : IRMA SURYATI
    NIM : C1B009139
    MGT G 09

    JUDUL :“ Hubungan Kualitas Pelayanan Pramuniaga Dengan Jumlah Pembeli Pada Swalayan Enha Kota jambi”.

    Irma, mengetahui jumlah pembelian itu sesuatu yg sulit, karena hampir tak ada individu yg mencatat jumlah pembelian. Tapi kalau anda melihat loyalitas, persepsi atas pelayanan Enha, itu mungkin dilakukan. Silahkan diperbaiki lagi judul sambil menulis latar belakang penelitian.

    Komentar oleh irma suryati | Desember 8, 2011 | Balas

    • salam pak jo,
      saya mau konfirmasi judul yang bapak sarankan untuk skripsi saya…
      yang awalnya “ Hubungan Kualitas Pelayanan Pramuniaga Dengan Jumlah Pembeli Pada Swalayan Enha Kota jambi”. MENJADI….
      ” hubungan kualitas pelayanan pramuniaga dengan loyalitas konsumen pada swalayan enha koya jambi”

      Komentar oleh irma suryati | Januari 2, 2012 | Balas

      • BAB 1
        PENDAHULUAN
        1.1 Latar Belakang
        Belakangan ini banyak pusat – pusat perbelanjaan berdiri di kota jambi. Hal ini merupakan salah satu indikator meningkatnya laju pertumbuhan ekonomi masyarakat jambi yang membuat banyak pengusaha tertarik menginvestasikan modal untuk mendirikan pusat – pusat perbelanjaan di kota jambi. Terus meningkatnya perekonomian masyarakat kota jambi di tandai dengan adanya peningkatan pendapatan yang dapat dibelanjakan (disposable income) dan perubahan gaya hidup masyarakat yang membuat kebutuhan akan produk juga semakin tinggi dan bervariasi.
        Seiring makin banyaknya jumlah produk yang di tawarkan membuat masyarakat makin selektif dalam memilih produk yang di butuhkannya. Apalagi informasi yang didapatkan konsumen mengenai produk sudah semakin sempurna, yang artinya akan semakin terbuka peluang konsumen dalam mengambil keputusan membeli. Kebutuhan dan keinginan konsumen yang semakin meningkat tentunya harus bisa terpenuhi oleh adanya penyedian produk yang memilki kualitas dan kuantitas terbaik.
        Di sisi lain, penawaran produk ke konsumen seharusnya sesuai dengan harapan konsumen, karena apabila produk yang ditawarkan tidak mampu memuaskan keinginan konsumen, akan berakibat berkurangnya loyalitas terhadap perusahaan dan kemungkinan terburuk adalah konsumen akan beralih pada perusahaan yang menawarkan produk sama dengan tingkat kepuasan yang lebih tinggi. Setiap perusahaan pasti berusaha untuk meningkatkan dan mempertahankan loyalitas pelanggannya. Kerena pelanggan merupakan asset yang sangat berharga untuk kelangsungan perkembangan perusahaan.
        Dalam kondisi persaingan mempertahankan pelanggan merupakan hal yang sangat penting bagi perusahaan hal ini didasarkan menurut Kotler (1995, hal 55) biaya untuk memperoleh pelanggan baru adalah lima kali lebih besar dari biaya yang harus di keluarkan untuk mempertahankan pelanggan yang sudah ada. Salah satu upaya untuk mempertahankan pelanggan adalah dengan memuaskan harapan pelanggan terhadap produk yang ditawarkan. Dikarenakan Begitu startegisnya posisi pelanggan bagi kelangsungan hidup perusahaan, maka dari itu perusahaan seharusnya tidak sekedar menonjolkan kualitas dan kuantitas produk saja, melainkan harus juga menonjolkan sistem pelayanan yang memberikan perhatian dan suasana nyaman kepada pelanggan, yang sering disebut dengan kepedulian terhadap pelanggan ( Costumer Care).
        Hadirnya pusat-pusat perbelanjaan di tengah-tengah kota masyarkat kota jambi sperti ramayana, matahari departement store, jambi prima mall, mal kapuk, meranti swalayan, dan yang terbaru jamtos hal ini adalah salah satu bentuk bagaimana para investor manafsirkan adanya peluang untuk memenuhi kebutuhan masyarakat akan barang dan jasa, begitu juga dengan pedagang pengecer melakukan hal yang sama. Selain bisa leluasa memilih barang yang di inginkan, konsumen juga mendapatkan pelayanan dari pramuniaga yang siap mendampingi konsumen berbelanja serta mendapatkan informasi tentang barang yang dibutuhkan.
        Swalayan yang baik, tentunya memiliki standar pelayanan pramuniaga, hal ini dikarenakan pramuniaga adalah ujung tombak dari sistem pemasaran. Apabila kualitas pelayanan yang diberikan tidak mampu memberi kepuasan dan kenyamanan pelanggan atau pelanggan kecewa, hal ini adalah kerugian bagi perusahaan. Seorang pramuniaga di tuntut untuk mampu melayani pelanggan dengan hati, tidak hanya ramah, dan murah senyum saja yang paling utama adalah mampu menbaca keinginan konsumen dan tanggap dengan situasi.
        Salah satu faktor yang mempengaruhi kesuksesan sebuah perusahaan adalah pelayanan yang diberikan kepada konsumen. Hal ini di dasarkan pada semakin besarnya persaingan, haruslah di sadari bahwasanya di perlukan pramuniaga berkualitas dan mampu memberi pelayanan yang maksimal kepada konsumen saat berbelanja, dan dijadikan barometer bagi pimpinan untuk terus meningkatkan kualitas pelayanan dan menonjolkan keunggulan dalam bersaing.
        Menurut stanton (1993, hal 351), tujuan konsep pemasaran adalah mengembangkan orientasi pelanggan untuk menjadi bagian manajemen. Sejajar dengan filsafat ini, cukup masuk akal apabila manejemen menetapkan sasaran mereka adalah kepuasaan konsumen.
        Konsumen yang mendapatkan kepuasan, tentunya akan menyampaikan kepuasannya kepada orang lain. Menurut mortimer R.F (1989 hal 25) konsumen yang puas saat akan bertransaksi, maka ia akan mengabarkan kepuasanya itu kepada orang lain minimal 13 orang, dan ia kan menyarankan orang yang di kabarinya untuk datang dan berbelanja di toko tersebut. Dari hal tersebut dapat dijadikan pedoman bahwa setiap pelayanan yang mampu memuaskan konsumen akan dijadikan konsumen sabagai sarana atau alat promosi gratis yang di peroleh perusahaan dan pada akhirnya jumlah pelanggan yang berbelanja akan semakin meningkat.
        Swalayan yang tidak begitu memperhatikan aspek pelayanan, lambat laun akan berpengaruh pada jumlah pengunjung yang semakin menurun dan sepi pembeli. Sebab pelayanan yang baik dan memuaskan dari pramuniaga merupakan salah satu faktor pendorong timbulnya keinginan pengunjung untuk meningkatkan jumlah belanja mereka. Menurut kotler (1995, hal 201), di dalam pengambilan keputusan berbelanja terdapat lima peranan yang di mainkan oleh orang yang berpengaruh terhadap keputusan membeli tersebut. Peran pertama adalah pencetus ide, yaitu orang yang pertama kali mengusulkan ide untuk membeli suatu produk atau jasa tertentu, peran kedua, pemberi pengaruh, adalah orang yang pandanganya atau pendapatnya mempengaruhi keputusan pembelian, peran ketiga, pengambilan keputusan, adalah seseorang yang memutuskan setiap komponen dalm keputusan pembelian yaitu apakah membeli atau tidak, apa yang akan di beli, bagaimana membeli dan dimana membeli. Peran keempat, pembelian adalah seseorang yang melakukan pembelian sebenarnya. Peran kelima, pemakai adalah seseorang yang menggunakan atau mengkonsumsi produk atau jasa tersebut.
        Dengan melihat keberadaan swalayan Enha selama ini dan kemampuannya untuk bertahan dalam persaingan yang cukup tajam karena makin banyaknya jumlah pusat-pusat perbelanjaan yang berdiri di kota jambi, tentunya perusahaan ini dalam kegiatan usahanya juga melaksanakan beberapa strategi untuk memuaskan konsumen. Oleh sebab itu, penggunaan pramuniaga yang mampu mempengaruhi keputusan konsumen berbelanja merupakan jaminan bagi perusaan bahwa swalayan Enha akan memenangkan persaingan yang semakin ketat.
        Untuk mengetahui tingkat pelayanan yang diberikan pramuniaga, maka penulis tertarik untuk melakukan penelitian yang berhubungan dengan kualitas pelayan yang di berikan oleh swalayan Enha. Asumsi sebagian konsumen ini tentu menarik untuk di teliti lebih lanjut. Begitu pentingnya aspek kualitas pelayan pramuniaga dan kaitannya dengan jumlah pembelian, maka penulis terdorong untuk mengadakan penelitian tentang “ Hubungan Kualitas Pelayanan Pramuniaga Dengan loyalitas konsumen Pada Swalayan Enha Kota jambi”.

        1.2 Perumusan Masalah
        Swalayan Enha sebagai perusahaan yang bergerak dibidang pemasaran produk-produk retail tentunya selalu mengikuti perubahan yang terjadi ditengah-tengah masyarakat kota jambi yang terjadi secra terus menerus baik langsung ataupun tidak langsung, hal ini akan mempengaruhi kehidupan dan tata ekonomi, cara cara pemasaran dan prilaku manusianya.
        Untuk itu di tuntut keahlian dan kemampuan manajemen atau pimpinan agar selalu memperbaharui pengenalan terhadap konsumen dan mencari strategi memenangkan persaingan atau paling tidak mempunyai kemampuan mempertahankan kelangsungan hidup perusahaan didalam lingkungan bisnis tersebut.
        Pola pelayanan yang memuaskan merupakan salah satu strategi yang bisa di gunakan pihak manajemen dalam meningkatkan jumlah pembeli serta meningkatkan citra perusahaan dimata konsumen. Sebaliknya apabila kualitas pelayanan kurang mampu mengkoordinir keinginan konsumen, maka besar kemungkinan konsumen tidak akan kembali untuk berbelanja dan beralih ke swalayan lain.
        Swalayan Enha yang berada di kota jambi di anggap memilki kualitas palayanan yang baik dan mampu memuaskan konsume. Anggapan konsumen ini terlihat dari jumlah pengunjung yang datang setiap hari, swalayan Enha tidak pernah sepi pengunjung. Sebuah swalayan yang memberikan kepuasan yang baik kepada pelanggan, tentunya tidak lepas dari kualitas pelayanan pramuniaga yang langsung berhubungan langsung dengan pelanggan. Semakin baik pelayanan pramuniaga terhadap pelanggan, tentunya berhubungan erat dengan peningkatan jumlah pembeli dan menimbulkan keinginan konsumen untuk berbelanja ulang di swalayan tersebut.
        Untuk mengetahui seberapa besar hubungan kualitas pelayanan pramuniaga terhadap peningkatan jumlah pembeli, maka yang menjadi permasalahan bagi penulis adalah “Bagaimana Hubungan Kualitas Pelayanan Dengan Jumlah Pembeli Pada Swalayan Enha Kota Jambi”.

        1.3 Tujuan Dan Manfaat
        1.3.1. Tujuan Peenelitian
        1. untuk mengungkapkan apakah ada hubungan antara kualitas pelayanan pramuniaga terhadap jumlah pembeli pada swalayan Enha.
        2. Untuk mengungkapkan seberapa baik kualitas pelayanan pramuniaga pada swalayan Enha.
        1.3.2. Manfaat Penelitian
        1. Dari sisi Akademis
        sebagai tambahan referensi bagi para akademis yang ingin memahami tentang kualitas pelayanan dengan jumlah pembeli.
        2. Dari sisi Praktisi
        Penelitian ini diharapkan sebagai informasi dan sumbangan pikiran yang bermanfaat bagi swalayan Enha, pemerintah dan pihak-pihak lainnya dalam membuat kebijakan-kebijakan di mas ayang akan datang.

        1.4. Ruang Lingkup
        Agar penelitian ini lebih terarah dan sesuai dengan permasalahan yang di angkat serta konsisten terhadap tujuan yang hendak dicapai, mka peneliti perlu untuk menetapkan batasan-batasan permasalahan dalam penulisan. Adapun ruang lingkup pembahasan penelitian yaitu:
        a. Tempat penelitian : kota jambi
        b. Perusahaan yang diteliti : swalayan Enha
        c. Aspek yang diteliti :kualitas pelayanan pramuniaga
        Dan jumlah pembeli

        BAB II
        Tinjauan Pustaka

        2.1 Landasan Teoritis
        2.1.1definisi dan konsep teori
        untuk memberikan arahan pembahasan penelitian ini, perlu diberikan suatu landasan teoritis yang terdiri dari definisi-definisi sebagai berikut:
        1. Manajemen menurut siswanto ( 2005 ;2)
        Manajemen adalah seni dan ilmu dalam perencanaan, pengorganisasian, pengarahan, pemotivasaian, dan pengendalian terhadap orang dan mekanisme kerja untuk mencapai tujuan
        2. menurut kotler (2002)
        manajemen pemasaran adalah proses perancanaan dan pelaksanaan pemikiran, penetapan harga, promosi serta penyaluran gagasan, barang dan jasa untuk menciptakan pertukaran yang memuasakan tujuan-tujuan individu dan organisasi.
        3. Menurut kotler dan A.B. susanto (2000, hal.19)
        Pemasaran adalah suatu proses sosial dan manejerial dimana individu dan kelompok mendapatkan kebutuhan dan keinginan mereka dengan menciptakan, menawarkan, menukarkan produk yang bernilai satu dengan yang lain.
        4. Sedangkan menurut parasuraman,et.al., dalam rambat(2001hal.148)
        Service quality adalah seberapa jauh perbedaan antara kenyataan dan harapan pelanggan atas layanan yang mereka terima/peroleh.

        5. Startegi pemasaran menurut kotler (2001, hal. 401)
        Strategi pemasaran adalah serangkaian pendekatan pokok yang akan digunakan oleh unit bisnis dalam mencapai sasaran yang telah ditetapkan terlebih dahulu.
        6. Menurut kotler dalam fandy (2002, hal.90)
        Kepuasan pelanggan adalah tingkat perasaan seseorang setelah membandingkan kinerja (hasil) yang ia rasakan dibandingkan dengan harapannya.
        7. Menurut Engel,et.at., dalam fandy (2000, hal. 89)
        Kepuasan pelanggan merupakan evaluasi pembeli dimana alternative yang dipilih sekurang-kurangnya sama atau melampaui
        harapan pelanggan, sedangkan ketidakpuasan timbul apabila hasil tidak memenuhi harapan.
        8. Konsumen
        Menurut ISO 8402 (1997, hal.124) adalah penerimaan barang atau jasa. Seorang konsumen dapat berupa pemakai, pengguna, ahli waris, atau pembeli. Konsumen dalam kegiatan bisnis sering disebut pihak kedua. Konsumen dapat berarti suatu unit dalam suatu organisasi.
        9. Analisis
        Menurut aji dan sirait (2001;11) anilisis adalah suatu usaha untuk mengukur dan memberi nilai secara obyektif pencapaian hasil-hasil yang telah dirancanakan sebelumnya, hasil-hasil evaluasi menjadi umpan balik untuk perencanaan kembali .
        10.
        Menurut nitisemito (1993) pelayanan merupakan salah satu kegiatan-kegiatan merketing bertujuan untuk meningkatkan omzet pen
        jualan dengan cara mempengaruhi konsumen atau tidak langsung.

        2.2 kerangka teoritis
        Tujuan pemasaran adalah memenuhi kebutuhan dan keinginan konsumen sasaran agar konsumen mendapatkan apa yang diharapkan. Pemasaran merupakan salah satu dari kegiatan-kegiatan pokok yang dilakukan oleh perusahan untuk mempertahankan kelangsungan hidupnya, untuk berkembang dan mendapatkan laba. Pemasaran mencakup usaha perusahaan yang dimulai dengan mengidentifisir kebutuhan konsumen yang perlu dipuaskan, menentukan produk yang hendak diproduksi.
        Pada kondisi sekarang ini diman perusahaan-perusahaan harus menghadapi persaingan yang ketat maka dibutuhkan suatu konsep pemasaran yang seuai dengan kebutuhan dan keinginan konsumen dengan tujuan agar dapat memenangkan persaingan. Kegiatan pemasaran bukan hanya menjual barang dan jasa saja, tetapi juga mengcakup kegiatan sebelum dan sesudah penjualan.
        Kepuasan berhubungan erat dengan kualitas pelayanan untuk memberikan dorongan kepada konsumen atau pelanggan untuk menjalin hubungan yang kuat dengan perusahaan. Dalm jangka panjang ikatan ini memungkinkan perusahaan untuk memahami dengan seksama harapan konsumen dimana perusahaan memaksimumkan pengalaman yang menyenangkan konsumen dan meminimumkan atau meniadakan pengalaman konsumen yang kurang menyenangkan pada dasarnya kepuasan konsumen dapat menciptakan kesetiaan kepada perusahaan yang memberikan kulitas pelayanan yang memuaskan.
        Kepuasan konsumen secara tidak langsung mampu meningkatkan pangsa pasar dan daya saing, serta dalam jangka panjang memungkinkan perusahaan setiap survive dan menghasilkan laba.
        Dengan adanya kepuasan konsumen maka perusahaan akan mendapatkan manfaat antara lain:
        1. Sebagai pendekatan kemampuan mendapatkan laba perusahaan, khususnya sebagai pertimbangan dalam perencanaan program pemasaran.
        2. Berfungsi sebagai pedomamn untuk mengarahkan pemenuhan kebutuhan pelanggan menjadi keungggulan daya saing yang berkelanjutan dalam pelayanan konsumen.
        3. Sebagai piranti untuk :
         Menelusuri masalah yang dihadapi perusahaan dalam kurun waktu serta identifikasi kebutuhan pelanggan.
         Memperbaiki proses manajemen produk dan service
         Mengetahui indikator tingkat pendapatan kualitas pelayanan.
        Dalam pemasaran produk biasanya disertai dengan pelayanan adapun kriteria yang merincikan pelayanan sekaligus yang membedakannya dengan barang, menurut Gazpersz (1997) adalah :
        a. Pelayanan merupakan output yang tak terbentuk
        b. Pelayan merupakan output variabel, tidak standar
        c. Pelayanan tidak dapat disimpan dalam inventory tetapi dapat dikonsumsi dalam produksi.
        d. Terdapt alam hubungan langsung yang erat dengan pelanggan melalui proses pelayanan.
        e. Pelanggan berpartisipasi dalam proses memberikan pelayanan.
        f. Keterampilan personel diserahkan atau diberikan langsung kepada pelanggan.
        g. Pelayanan tidak diproduksi secara massal.
        h. Membutuhkan pertimbangan pribadi yg tinggi dari individu yang memberikan pelayanan.
        i. Perusahaan jasa pada umumnya bersifat padat karya.
        j. Fssilitas pelayanan berada dekat dengan lokasi pelanggan.
        k. Pengkuran efektifitas pelayan bersifat subyektif.
        l. Pengendalian kualitas terutama di batasi pada pengendalian proses.
        m. Option penetapan harga adalah sulit.

        salam pak jo,
        untuk sampel dan populasi akan segera saya lengkapi pak,….

        Komentar oleh irma suryati | Januari 13, 2012

  13. Nama : Mariaty Sitompul
    NIM : C1B009015

    JUDUL : “Analisis pengaruh perubahan merk/brand terhadap tingkat penjualan pada Novita Hotel Jambi”

    Komentar oleh Mariaty | Desember 8, 2011 | Balas

  14. TUGAS 1 (INDIVIDU)
    NAMA : AKBAR MAULANA
    NIM : C1B008126
    KELAS : MGT G 08

    JUDUL : “Analisis Kualitas Pelayanan Pada PT.POS INDONESIA di Jambi”.

    PT. Pos mempunyai pelayanan yg sangat luas, hendaknya dibatasi kepada satu hal saja, misalnya dalam pengiriman paket. Kalau ini dilakukan, perbandingan bisa dilakukan antara PT Pos dan Biro lain. Karena Biro lain seperti JNE menggunakan fasilitas antara Jemput. Silahkan temanmu yg lain mencari judul untuk pelayanan seperti JNE misalnya. Kerjakan lebih lanjut.

    Komentar oleh Akbar Maulana | Desember 8, 2011 | Balas

  15. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL : “Analisis Strategi Bauran Pemasaran Eceran Yang Menentukan Tingkat Kepuasan Konsumen Pada ABADI Swalayan Jambi”

    Abadi adalah pengecer, kemudian hendak diteliti bauran pemasaran. Saran saya tidak seluruh komponen bauran pemasaran ditetapkan oleh Abadi. Misalnya untuk harga, lebih ditentukan pabrik, sementara untuk tempat tidak dilakukan oleh Abadi, karena Abadi menampilkannya pada satu tempat saja. Kalau hendak meneliti ini juga temukan variabel lain dalam bisnis pemasaran. Topikmu bagus, kekurangannya cuma pendekatan. Ditunggu perbaikanmu. Lebih Giat Lagi.

    Komentar oleh Rahmat | Desember 9, 2011 | Balas

  16. tugas 1 (individu)
    nama : novita kurniawati
    nim : C1B009149
    mgt “G” kelas pagi

    JUDUL : “ANALISIS FAKTOR-FAKTOR PENYEBAB TIDAK TERCAPAINYA TARGET PENJUALAN RUMAH TOKO DI ASTON VILLA PADA PT.NIAGA GUNA KENCANA.”

    Novita, jangan menggunakan kata tidak tercapainya, tapi gunakan kata yg lebih netral. Misalnya, analisis pemasaran penjualan rumah toko PT. Niaga KEncana.

    Silahkan diulang lagi.

    Komentar oleh novita kurniawati | Desember 12, 2011 | Balas

    • BAB 1
      PENDAHULUAN

      1.1 Latar Belakang
      Setiap perusahaan mempunyai tujuan yang telah ditetapkan sebelumnya. Tujuan ini merupakan sesuatu yang ingin dicapai dalam rangkaian kegiatan perusahaan tersebut. Bila sebuah rangkaian perusahaan tidak mampu mencapai tujuan yang diinginkan, maka dapat dikatakan bahwa perusahaan sudah tidak berfungsi lagi sebagaimana mestinya.
      Perana usaha pemasaran sangat diperlukan dalam memudahkan sebuahperusahaan dalam merencanakan kebutuhan. Jadi diharapkan dengan melakukan kegiatan pemasaran, sebuah perusahaan yang menjual produk/barang atau jasa dapat memberikan sebuah ketertarikan atau minat konsumen terhadap barang dan jasa yang ditawarkan oleh perusahaan tersebut.
      Sebagai perusahaan pada umumnya,PT.Niaga Guna Kencana juga dihadapkan pada masalah pemasaran, yaitu yang berhubungan dengan perencanaan produk, penentuan hargaa, promosi dan pendistribusian perumahan. Penyediaan rumah untuk masyarakat yang berpenghasilan menengah kebawahmasih merupakan agenda penting bagi perusahaan dalam ikiut serta mendukung pembangunan bangsa dimasa yang akan datang. Diperkirakan pada tahun-tahun mendatang kebutuhan dalam pembangunan perumahan baru bagi penduduk daerah perkotaan mencapai angka sampai dengan 10.000 unit.
      Dalam menjalankan tugasnya perusahaan selalu dihadapkan oleh beberapa kendala persaingan dari perumahan developer lainnya yang ada dijambi misalnya, perumahan aurduri, puri masurai, dan lain-lain, yang melakukan kegiatan promosi di media cetak seperti koran-koran.
      Untuk menyuediakan produk rumah yang memadai dengan harga yang terjangkau perusahaan telah membangun sebuah proyek perumahan aston villa yang menyediakan berbagai tipe rumah dengan harga tertentu separti tipe T 29 ( RSH lantai keramik) dengan harga Rp 55 jt, T 36 dengan harga Rp 84 jt-an, Tipe 45 harga Rp 112 jt-an, dan pertokoan K 36 dengan harga Rp 99 jt-an. Kesemua tipe tersebut dapat Anda peroleh dengan cara bayar yang sangat ringan dan terjangkau. Namun demikian selam tiga tahun terakhir kegiatan penjualan perumahan aston villa ini tidak menunjukkkan kenaikan penjualan yang signifikan sehingga pada saat ini perumahan aston villa masih sepi penghuni begitu juga dengan tipe rukonya yang sampai saat ini hanya 40% dihuni.
      Dengan tidak tercapainya target penjualan pada perumahan aston villa ini maka penulis tertarik untuk melakukan penelitian yang berjudul “Analisis Startegi Pemasaran Penjualan Rumah tipe ruko pada PT.Niaga Guna Kencana di perumahan aston villa jambi”.

      Komentar oleh novita kurniawati | Desember 21, 2011 | Balas

      • BAB I
        PENDAHULUAN
        1.1 Latar Belakang

        Kegiatan pemasaran dalam suatu perusahaan merupakan unsur yang penting dalam menjamin keberlangsungan usaha, disamping fungsi-fungsi pemasaran lain seperti : produksi, keuangan, personalia, serta riset dan pengembangan. Didalam aktifitas perusahaan antara bagian pemasaran, keuangan, produksi, personalia satu sama lain harus saling berkoordinasi. Kegiata produksi tidak akan berlangsung jika tidak ada dana, sedangkan dana akan diperoleh jika perusahaan melakukan kegiatan pemasaran produknya.

        Secara umum aktifitas perusahaan adalah untuk memaksimalkan perolehan laba, hal ini penting agar perusahaan dapat berkerlanjutan lain dalam hal produksi, menunaikan kewajiban-kewajiban maupun pengembangan usaha. Laba rugi sebuah perusahaan tidak menjadi sesuatu yang diatas segala-galanya. Perusahhan harus mampu menciptakan suasana yang harmonis antara pihak-pihak yang terlibat dalam aktifitas perusahaan tersebut mulai dari distributor sampai pada konsumen akhir. Manajemen pemasaran menurut kotler, adalah kegiatan penganalisaan, perencanaan, pelaksanaan dan pengemasan program-program yang ditujukan untuk mengadakan pertukaran dengan pasar yang dituju dengan maksud tercapainya tujuan organisasi.

        Aktifitas pemasaran yang dilakukan perusahan harus mengacu pada kemampuan perusahaan iitu sendiri. Pada dasarnya pemasarn merupakan suatu kegiatan yang paling penting dalam suatu perusahaan, karena perusahaan baru dapat tercapai apabila hasil-hasil produksi telah terjual. Agar hasil produksi dapat terjual dan memberikan keuntungan, maka kegiatan pemasaran harus dilaksanakan dengan baik.

        Setiap perusahaan mempunyai tujuan masing-masing yang ingin dicapai, tujuan tersebut dapat berupa usaha untuk meningkatkan volume penjualan, memperbesar market share, memperoleh laba optimal dan mempertahankan kelangsungan hidup perusahaan.

        Keberhasilan sebuah perusahaan dalam memasrkan produk bukanlah hal yang mudah, memasarkan produk itu tidak hanya menjual atau menukarkan dengan sesuatu. Tetapi berusaha memenuhi kebutuhan dan keinginan konsumen. Tercapainya kepuasankonsumen dapat menciptakan hubungan baik antara kedua belah pihak. Untuk memprlajari konsumen tidak hanya mengetahui apa (what ) yang dibelinya saja, tetapi bagaimana (how ) kebiasaan dan dalam kondisi seperti apa barang tersebut dibelinya.

        Dewasa ini banyak perusahaan menggunakan konsep pemasaran dengan tujuan untuk memberikan kepuasan terhadap kebutuhan dan keinginan konsumen atau berorientasi pada konsumen. Kegiatan pemasaran suatu perusahaan harus dimulai denagn usaha mengenal dan merumuskan keinginan dan kebutuhan dari konsumen kemudian merancang strategi pemasarannya. Hal ini sesuai dengan pendapat kotler (1992) yang menyatakan bahwa kunci untuk mencapai sukses tujuan organisasi terdiri dari penentuan kebutuhan dan keinginan pasar sasaran serta memberikan kepuasan yang diharapkan secara lebih efektif dibanding para pesaing.

        Untuk mengetahui keinginan dan kebutuhan konsumen perlu dilakukan kajian mengenai prilaku konsumen, dimana konsumen selaku manusia memiliki karakteristik yang berbeda-beda baik itu menurut usia, pendapatan, tingkat pendidikan, pola perpindahan tempat, selera dan juga cara memandang sesuatu. Dari perbadaan karakteristik yang ada pada konsumen diatas maka menyebabkan ada perilaku konsumen yang bermacam-macam pula. Hal ini menggambarkan berapa besra pentingnya bagi perusahaan untuk mengetahui prilaku konsumen dalam upaya memenuhi keinginan dan kebutuhan konsumen, dan ini akan membentuk prilaku konsumen dalam melakukan pembelian.

        Salah satu kebutuhan pokok manusia yaitu papan atau yang disebut rumah sebagai tempat berlindung dari panas dan hujan. Produk ini dapat diterima masyarakat karena memang perumahan merupakan suatu kebutuhan yang sangat penting bagi konsumen. Namun, karena pertimbangan akan proses pembuatannya yang lama dan membutuhkan biaya yang cukup besar membuat konsumen ingin memperoleh tempat tinggal dengan cara yang praktis dan dengan kemudahan biayanya maka disini pemasar memberikan solusi yaitu dengan memproduksi suatu perumahan yang dapat dibayar dengan kemudahan kredit berjangka.

        Pada saat ini konsuman dapat dengan mudah menemukan berbagai jenis perumahan yang ditawarkan oleh berbagai perusahaan sesuai dengan kebutuhan masing- masing konsumen. Dengan kondisi pasar tersebut perusahaan berusaha menghasilkan produk yang berkualitas, mulai dari produksi sampai produk tersebut berada di tangan konsumen, meningkatkan kualitas produk yang nantinya dapat bersaing dipasaran dengan produk lain.

        Banyaknya jenis perumahan yang ditawarkan oleh pemasar menyababkan tingkat persaingan di industri perumahan menjadi semakin ketat. Baik itu perumahan kualiatas biasa maupun perumahan kualitas tinggi dengan fasilitas, tempat, keamanan, dan fasilitas lain yang mendukung suatu keingina konsumen terhadap perumahan tersebut.
        Sejak Pemerintah Kota Jambi melakukan pelebaran pada jalan Patimura menjadi dua jalur, laju perkembangan Kota Jambi di arah barat sangat pesat dan luar biasa. Di seputaran pertigaan Simpang Rimbo, misalnya, di setahun belakangan ini laju pertumbuhannya sangat meroket. Bahkan daerah ini bisa dibilang sebagai pusat pertumbuhan.

        “Pertumbuhan pembangunan di wilayah barat di Kota Jambi pada tahun belakangan ini memang saat pesat. Karenanya tepat sekali bila PT NGK mendirikan perumahan di sini.

        ASTON VILLA, yang berlokasi hanya 100 meter dari lampu merah simpang Aurduri, 3 menit ke UNJA, 6 menit ke IAIN serta 20 menit ke Tugu Juang Sipin ,tidak salah lokasi ini merupakan lokasi yang strategis secara geografis berada di area lingkungan akademis yang bergengsi, sehingga tak luput menjadi pilihan para konsumen sebagai dampak dari tingginya market Valencia.

        Infra Struktur jalan aspal, fasum lapangan Futsal, taman,fasos sarana Ibadah Mesjid telah dibangun, listrik, air PDAM telah siap untuk disambungkan kesetiap unit rumah karena jaringan sudah tersedia.

        Margin kebutuhan costumer lain yang bernuansa hunian nyaman dengan konsep rumah minimalis modern dengan prinsip denah rumah tumbuh terdiri dari dua kamar tidur yaitu type 36/90 dan type 36/96, untuk type 45/160 yang lebih bisa memberikan keleluasaan pengembangan mengingat tanah sisa besar, type 47/96 konsep rumah siap huni dengan kelengkapannya carport untuk mobil,dapur plus meja dapur permanen, taman belakang yang sudah tertutup pagar ,sehingga memungkinkan konsumen tanpa harus menambah ruangan tambahan lagi karena sudah siap huni. jelas Ir. Kustiwa selaku Project manager.
        Aston Villa hadir di kawasan ini dengan konsep perumahan yang telah mengantisipasi laju perkembangan daerah seperti pembuatan jalan lingkungan dalam yang memiliki lebar 8 meter. Aston Villa juga didukung dengan keberdaan puluhan pertokoan yang telah beroperasi, sehingga memudahkan para warga untuk mendapatkan kebutuhan sehari-hari.
        Ihwal fasilitas di dalam lingkungan, selain sudah dilengkapi fasilias utama, seperti air dan listrik, Aston Villa telah memiliki berbagai taman yang asri yang sangat menunjang keindahaan lokasi. “Untuk sarana dan prasana, tentu sebagai pengembang kita selalu menempatkan hal tersebut sebagai yang utama. Jadi semua fasilitas telah kita siapkan,” tambah Kustiwa yang menambahkan akan terus melakukan berbagai program promosi untuk mendongkrak penjulan Aston Villa.
        Perumahan aston villa memiliki banyak pesaing seperti perumahan perumahan aurduri, perumahan bahri makmur, perumahan puri masurai dan perumahan lain yang berada disekitarnya.

        Dengan banyaknya pilihan akan jenis perumahan, maka konsumen memiliki berbagai jenis pilihan perumahan yang mereka sukai. Untuk itu perusahaan dituntut untuk tahu apa kebutuhan dan keinginan konsumen, agar perusahaan dapat menciptakan perumahan dengan kualitas yang baik, fasilitas yang memadai, menarik yang diinginkan oleh konsumen.
        Dalam penelitian ini penulis hanya membahas salah atu produk perumahan dari aston villa yaitu rumah toko (ruko) yang diproduksi oleh PT. Niaga Guna Kencana. Aston villa mulai di produksi pada tanun 2008, terdapat berbagai jenis perumahan termasuk rumah toko yang ditwarkan oleh perusahaan ini. Namun, sampai pada tahun 2011 perumahan tersebut belum dapat mencapai target penjualannya sehingga sampai saat ini perumahan tersebut masih sepi penghuni atau belum terjual sepenuhnya.

        Berdasarkan uraian diatas penulis tertarik untuk melakukan penelitian yang berhubungan dengan perilaku konsumen terhadap produk perumahan ruko pada aston villa tersebut. Dalam penelitian ini penulis juga mengambil penduduk yang telah menghuni rumah toko di aston villa tersebut sebagai objek penelitian untuk mengetahui bagaiman perilaku konsumen terhadap pemilihan produk perumahan tersebut.

        Maka judul dari penelitian ini adalah “ Analisis strategi pemasaran pada penjualan rumah toko di perumahan Aston Villa Jambi.”

        1.2 Perumusan Masalah

        JAMBI – Ekspansi menjadi perhatian yang sangat serius bagi PT Niaga Guna Kencana (NGK). Developer ini sekarang menjelma menjadi patokan/referensi bagi masyarakat Jambi ketika akan membeli rumah. Dalam kiprahnya yang sudah memasuki tahun kelima, telah meluncurkan 11 proyek perumahan dan bangunan komersial. Proyek-proyek yang masih dipasarkan saat ini antara lain Villa Gading Mayang (SOLD OUT), Barcelona Regency (tinggal 1 unit), Atalanta Regency, Aston Villa, Liverpool Estate, Parma Residence, Arsenal Estate dan Valencia. Dalam bulan ini NGK juga akan meluncurkan proyek perumahan di jalan Baru Pipa dekat SMP 16 Mayang.

        Developer ini memang sangat jeli membaca pasar dan sangat akomodatif terhadap trend gaya hidup. Menurut PM NGK Dodi, keunggulan perumahan yang dibangun NGK adalah pemilihan lokasi kompleks perumahan yang sangat strategis, penataan dan konsep perumahan yang baik dan kami sangat memperhatikan infrastruktur. Secara kasat mata, infrastruktur perumahan NGK seperti jalan, taman, jaringan air bersih, jaringan listrik dan lainya selalu diprioritaskan. Fasilitas tersebut dibangun berbarengan dengan membangun rumah, sehingga ketika konsumen menempati rumahnya, kompleks sudah tertata rapi. Meskipun kadang rumah yang dibangun type kecil, namun suasananya tampak lega dan nyaman.

        Perumahan yang berlokasi di tepi jalan lintas Simpang Aurduri, dengan taman dan Patung Liberty, merupakan kompleks yang strategis di gerbang kota Jambi. Bagi Anda yang ingin segera pindah rumah, Aston villa menyediakan ratusan rumah siap huni dengan prasarana yang telah siap seperti jalan beraspal, jaringan listrik, dan air bersih telah siap tersalur ke setiap rumah. Selain itu rumah sudah berlantai keramik, plafon dan cat luar dalam. Kesemuanya itu dapat diperoleh dengan tetap menggunakan skema RSH program pemerintah yakni harga Rp 55 jt dan KPR bersubsidi.
        Ada beberapa tipe rumah yang ditawarkan di Aston villa, mulai dari T 29 ( RSH lantai keramik) dengan harga Rp 55 jt, T 36 dengan harga Rp 84 jt-an, Tipe 45 harga Rp 112 jt-an, dan pertokoan K 36 dengan harga Rp 99 jt-an. Kesemua tipe tersebut dapat Anda peroleh dengan cara bayar yang sangat ringan dan terjangkau.

        perilaku konsumen dalam memilih produk perumahan untuk memuaskan kebutuhan dan keinginannya dipengaruhi oleh enam faktor yaitu place, place, place, place, place, dan mooney. Dari faktor tersebut dapat dikatakan bahwa keberadaan dimana perumahan tersebut di produksi adalah faktor yang paling mempengaruhi perilaku konsumen terhadap pemilihan perumahan yang memenuhi kebutuhan dan keinginannya. Pada dasrnya Faktor-faktor tersebut adalah faktor yang dapat dikendalikan oleh perusahaan tetapi harus benar-benar di pertimbangkan.

        Saat ini banyak terdapat pilihan produksi perumahan dari yang berada ditengah kota ataupun berada di gerbang kota atau dekat dengan fasilitas-fasilitas pendidikan. Semua itu ditawarkan untuk memenuhi kebutuhan dan keinginan konsumen. Untuk itu pemahaman mengenai prilaku konsuman sangatlah penting , karena bnyak perubahan-perubahn yang secara terus-menerus terjadi di pasar. Perubahan-perubahan tersebut banyak terjadi karena banyaknya pilihan dari berbagai produk perumahan yang menawarkan dengan tempat, fasilitas, keamanan yang berbeda-beda yang secara terus menerus bertambah di pasaran. Sehingga semakin gencarnya kehadiran produk baru akan semakin meningkatkan iklim persaingan sesama produsen.

        Maka yang menjadi permasalahan utama dalam penelitian ini adalah “ faktor-faktor apakah yang mempengaruhi perilaku konsumen dalam pemilihan produk rumah toko di perumahan Aston Villa Jambi?”.

        1.3 Tujuan Penelitian
        Tujuan dilakukan penelitian ini adalah :
        1. Untuk mengetahui apakah variabel tempat, fasilitas pendukung, harga, kondisi, keamanan berpengaruh secara signifikan terhadap perilaku konsumen.
        2. Untuk menganalisis variabel yang berpengaruh dominan terhadap pembelian produk perumahan pada perumahan aston villa jambi.

        1.4 Manfaat Penelitian
        Manfaat dari penelitian ini adalah :
        1. Hasil penelitian ini dapat dijadikan salah satu informasi bagi PT. Niaga kencana khususnya pada produksi perumahan aston villa mengenai perilaku konsumen dalam memilih produk rumah toko yang sesuai dengan kebutuhan dan keinginan konsumen.
        2. Menjadi sumbangan pemikiran secara empiris serta untuk pengembangan ilmu pengetahuan khususnya manajemen pemasaran.

        BAB 11
        TINJAUAN PUSTAKA

        2.1 Definisi-Definisi
        William (1995;5) mendefinisikan ilmu ekonomi adalah suatu studi tentang prilaku orang dan masyarakat dalam memilih sumberdaya yang langka dan memiliki beberapa alternatif penggunaan, dalam rangka memproduksi berbagai komoditi, untuk kemudian menyalurkannya baik saat ini maupun dimasa depan kepada berbagai individu dan kelompok yang ada dalam suatu masyarakat.
        Manajemen menurut T. Handoko (2000;3) adalah perencanaan (penetapan apa yang akan dilakukan), pengorganisasian, penyusunan personalia (penarikan, seleksi, pengembangan, pemberian kompensasi dan penilaian prestasi kerja), pengadaan dan pengawasan.
        Menurut sofwan assauri (1990;79) manajemen adalah kegiatan atau usaha untuk mencapai suatu tujuan dengan mengkoordinir kegiatan orang lain.
        Pemasaran menurut philip khotler (1998;5) adalah suatu proses sosial dimana individu dan kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengancara menciptakan dan mempertukarkan produk dan nilai dengan individu dan kelompok lainnya.
        Sedangkan menurut William (1995;5) mengemukakan pemasaran adalah sistem keseluruhan dari kegiatan-kegiatan bisnis yang ditujukan untuk merencanakan, menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan, baik kepada pembeli yang ada maupun kepada pembeli yang potensial.
        Penjualan menurut Basu Swasta (1995;125) adalah suatu ilmu dan seni untuk mempengaruhi pribadi yang dilakukan oleh penjual untuk mengajak orang lain agar bersedia membeli barang dan jasa yang ditawarkan.
        Sedangkan menurut William (1995;8) pengertian penjualan adalah bagian dari promosi. Sedangkan promosi adalah salah satu bnagian dari keseluruhan sistem pemasaran.
        Stategi penjualan menurut Fandy Tjiptono (2000;249) adalah memindahkan lokasi posisi pelanggan ketahap pembelian (dalam proses pengambilan melalaui penjualan tatap muka).
        Target menurut (kamus besar bahasa Indonesia 2000;902) adalah sasaran yang telah ditetapkan untuk dicapai, sedangkan target penjualan adalah sasaran yang ingin dicapai didalam kegiatan penjualan barang dan jasa.
        Perum perumnas adalah penyediaan pelayanan bagi pemanfaatan umum dan sekaligus ini memupuk keuntungan berdasarkan prinsip pengelolaan perusahaan di sektor pengadaan perumahan dan pemukimam terutama bagi golongan masyarakat berpenghasilan menengah kebawah yang menganut prinsip persaingan bebas (menurut pp No.29 tahun 1974).
        Visi dari perusahaan perumahan yaitu menjadi perusahaan yang sehat tumbuh dan berkembang sehingga mampu berperan sebagai penggerak pembangunan perumahan dan pemukiman yang layak dan terjangkau terutama untuk golongan masyarakan berpenghasilan menengah kebawah dalam rangka mendorong pengembangan perkotaan yang terarah.
        Sedangkan misi dari perusahaan perumahan yaitu :
        1. Menggerakan pembangunan perumahan dan pemukiman dalam rangka mendorong pembangunan kota yang terarah dan meningktkan kualitas kehidupan masyarakat.
        2. Melaksanakan kegitan pembangunan perumahan dan pemukiman dikawasan baru maupun peremajaan kawasan yang layak dan terjangkau terutama untuk golongan masyarakat berpengjasilan menengah kebawah dan menciptakan kesempatan usaha dan lapangan kerja.
        3. Memupuk keuntungan berdasarkan prinsip pengelolaan perusahaan yang sehat sehingga dapat tumbuh dan berkembang dalam menjalankan misinya.

        2.2 Kerangka Teoritis
        Suatu perusahaan tidak bertahan bilamana perusahaan tersebut tidak mampu menjual berupa barang atau jasa yang dihasilkannya. Penjualan bukan sekedar memindahkan dari gudang perusahaan ke gudang pembeli dan perusahaan menerima uang dari pembeli sesudah itu selesai, namundidalam penjualan itu terkandung keinginan perusahaan untuk memuaskan konsumen dengan hasil produksinya. Dengan demikian tujuan perusahaan yaitu memperoleh laba dapat tercapai.
        Dalam rangka memenuhi kebutuhan konsumen dan mencapai tujuan perusahaan, seorang pemimpim harus mengambil suatu kebijakan pemasaran yang tepat agar produk perusahaan dapat dipasarkan terjual semaksimal mungkin.
        Adapun titik tolak untuk membuat kebijkan pemasaran adalah unsur-unsur marketing mix yaitu menyangkut keputusan-keputusan dari empat variabel sebagai berikut menurut philip khotler (2005;20)
        1. Keputusan tentang produk.
        2. Keputusan tentang harga.
        3. Keputusantentang promosi.
        4. Keputusan tentang tempat.
        Penjualan dapat tercipta sutu proses pertukaran barang atau jasa antara penjual dengan pembeli. Di dalam perekonomian seseorang yang menjual sesuatu akan mendapatkan imbalan berupa uang. Dengan alat penukaran berupa uang akan lebih mudah memenuhi segala keinginannnya dan penjualan lebih mudah untuk dilakukan.
        Dalam praktek kegiatan penjualan itu dipengaruhi oleh beberapa faktor. Faktor-faktor tersebut adalah :
        1. Faktor Internal
        Faktor internal disini adalah dimana faktor yang terjadi didalam perusahaan yang dapat mempengaruhi kegiatan penjualan diantaranya adalah :
        a. Kondisi dan Kemampuan Penjual
        Transaksi jual beli atau pemindahan hak milik secara komersial atas barang dan jasa itu pada prinsipnya melibatkan dua pihak, yaitu penjual sebagai pihak pertama dan pembeli sebagai pihak kedua. Disini penjual harus dapat meyakinkan kepada pembeli agar dapat berhasil mencapai sasaran penjualan yang diharapkan. Untuk maksud tersebut penjual harus memahami beberapa masalah penting yang sangat berkaitan yaitu :
        • Jenis dan karakteristik barang yang ditawarkan.
        • Harga produk.
        • Syarat penjualan seperti : pembayaran, penghantar, pelayanan purna jual, garansi dan sebagainya.
        Masalah-masalah tersebut biasanya menjadi perhatian pembeli sebelum melakukan pembelian.
        b. Modal dan Promosi
        Akan lebih sulit bagi penjual untuk menjual barangnya apabila barang yang dijual tersebut belum dikenal oleh pembeli atau apabila lokasi pembeli jauh dari tempat penjual. Dalam keadaan seoerti ini, penjual harus memperkenalkan dulu atau membawa barangnya ketempat pembeli. Untuk melaksanakan maksud tersebut diperlukan adanya sarana serta usaha, seperti alat transportasi, tempet peragaan baik didalam perusahaan maupun di luar perusahaan, usaha promosi dan sebagainya. Semua itu hanya dapat ilakukan apabila penjual memiliki sejumlah modal yang diperlukan untuk itu.
        c. Kondisi Organisasi Perusahaan
        Pada perusahaan besar biasanya masalah penjualan ini ditanganioleh bagian tersendiri yang di pegang oleh orang-orng tertentu di bidang penjualan. Lain halnya dengan perusahaan kecil dimana masalah penjualan ditangani juga oleh orang yang juga melakukan fungsi-fungsi lain. Hal ini disebabkan oleh jumlah tenaga kerjanya lebih sedikit, sistem organisasinya lebih sederhana, masalah-masalah yang dihadapi serta sarana yang dimilikinya juga tidak sekompleks perusahaan besar. Biasanya masalah penjualan iniditangani sendiri oleh pimpinan dan tidak diberikan kepada orang lain.
        2. Faktor Eksternal
        Faktor eksternal ini adalah faktor yang berasal dari luar dari masalah perusahaan. Dimana faktor-faktor tersebut adalah :
        • Lingkungan Makro
        Lingkungan makro merupakan kekuatan yang melingkupi dan secara langsung dan secara tidak langsung terhadap perusahaan lingkungan makro disini lebih banyak berhubungan dengan kebijakan pemerintah, dimana kebijakn pemerintah sering terjadi pertentangan antar satu instansi dengan instansi lainnya. Sehingga perusahaan sangat sulit untuk mengambil kebijakan didalam meningkatkan kegiatan penjualan. Sedangkan untuk permasalahan hukum tidak terlalu berpengaruh karena sudah ada prosedur yang ditetapkan oleh pusat.
        • Kondisi Pasar dan Pesaing
        Pasar sebagai kelompok pembeli atau pihak yang menjadi sasaran dalam prnjualan, dapat juga mempengaruhi kegiatan penjualan. Afapun faktor-faktor kondisi pasar yang perlu diperhatikan :
        a. Jenis pasarnya, apakah pasar konsumen, pasar industri, pasar penjual, pasr pemerintah, atau pasar internasional.
        b. Kelompok pembeli atau segmen pasarnya.
        c. Daya belinya.
        d. Frekuensi pembelinya.
        e. Keingina dan kebutuhan.
        Perusahaan dalam hal ini sekedar memiiki kombinasi yang terbaik saja tetapi keempat variabel tersebut harus di koordinir agar perusahaan dapat melaksanakan tugas pemasarannya seefektif mungkin. Berikut ini akan diuraikan secar ringkas masing-masing variabel yaitu :
        a. Produk
        Keputusan mengenai produk ini berkaitan dengan penentuan bentuk penawaran secara fisik, pemberian merk, pembungkus, warna dan bentuk yang lainnya dengan demikian kebijakan produk ini harus dipasarkan pada keinginan dan kemampuan konsumen. Dari segi produk ini menurut Sukanto Rekohadiprojo, segi yang perlu mendapatkan perhatian adalah :
        1. Pengembangan produk baru
        Dengan semakin meningkatnya persaingan, perusahaan hendaknya terikat pada bentuk yang sudah ada, perusahaan harus mencari produk baru yang sesuai dengan perubahan selera konsumen.
        2. Siklus hidup produk
        Dalam siklus hidup produk ini ada berbgai uasaha yang dapat dijalankan. Untuk itu perusahaan harus dapat mengkaji apa yang terjadi pada penjual, sehingga keuntungan perusahaan, arus kas, langganan dan pesaing dalamfase masa pengenalan, pertumbuhan, kedewasaan penurunan produk.
        3. Campuran produk
        Yakni semua garis penutup dan jenisnya yang ditawarkan penjual kepada pembeli dalam hal ini garis produk, pengusaha dapat membuat mahal bila telah diproduksi murah atau produk besar bila telah diproduksi kecil. Jadi dalam hal ini pengisian garis dimaksud untuk memperoleh tambahan keuntungan denganmenambah jenis produk.
        Setiap perusahaan yang menjual suatu produk dan jasa mempunyai tujuanyang sama yaitu keberhasilan dalam mempertahankan kelangsungan hidup perusahaan (survive) mendapatkan laba dan dapat berkembang. Untuk merealisasikan tujuan tersebut adalah dengan meningkatkan omset penjualan perusahaan.
        Untuk mencapai omset penjualan dan dapat mencapai target pasar maka diperlukan strategi penjualan yang tepat dalam memasarkan produk tersebut di pasar.
        Menurut Widyaningtyas. S. (2002;1) di dalam kegiatan penjualan objek oleh pihak penjual dan pihak pembeli adalah sesuatu yang dinamakan dengan produk. Suatu produk dikatakan bermanfaat bila dengan pembelian atau dengan penggunaan produk tersebut, masalah konsumen / pembeli terpecahkan. Jadi pada dasarnya konsumen tidak hanya membeli produk secara fisik. Dengan kata lain konsumen membeli manfaat.
        Menurut kotler (1996;55) kita dapat membagi produk kedalam tiga tingkat yakni inti produk, wujud produk, produk yang di sempurnakan.
        1. Inti produk
        Inti produk adalah nilai kegunaan atau manfaat yang dapat memenuhi kebutuhan yang tersembunyi di balik setiap produk.
        2. Wujud Produk
        Wujud produk adalah bentuk produk yang secara fisik dapat dilihat atau diraba secara abstrak dapat dinilai atau dirasakan (untuk produk jasa). Ada lima karakter dari wujud produk, kelima karakteristik wujud produk tersebut adalah : ciri / khas, corak, gaya / model, merk dan kemasan.
        3. Produk yang disempurnakan
        Produk yang disempurnakan adalah diversifikasi manfaat atau kegunaan yang ditambahkan pada inti dan wujud produk, sehingga meningkatkan nilai tambah bagi produk.
        Menurut widyaningtyas sistaningrum (2002;15) penjualan produk terdiri dari barang dan jasa, pelayanan dalam penjualan barang dan jasa tersebut merupakan kegiatan yang tidak kalah pentingnya dalam upaya meningkatkan kualitas produk barang dan jasa yang dijual.
        Tujuan dari kegiatan pelayanan tidak lain adalah Customer Satisfaction atau kepuasan. Jadi jika konsumen meras puas dengan produk atau pelayanan penjualan diharapkan konsumen tersebut menjadi pelanggan.
        b. Harga
        Harga barang atau produk merupakan faktor penting yang menentukan keberhasilan penjualan suatu perusahaan yang menjual dengan harga yang lebih murah pasti akan mendapat pelanggan yang lebih banyak. Dalam hal ini produsen harus lebih hati-hati di dalam menghitung biaya untuk menetapkan harga produknya pada saat ada penawaran dari pembeli. Penetapan harga ini bisa didasarkan pada beberapa aspek antara lain :
        1. Biaya
        2. Permintaan, dan
        3. Persaingan.
        c. Promosi
        Faktor lain yang tidak kalah pentingnya untuk meningkatkan pemasaran adalah promosi. Karena perusahaan tidak hanya dapat tinggal diam menunggu konsumen mencari produksinya melainkan harus berusaha mengenalkan produk kepada konsumen baik secara langsung maupun tidak. Untuk itu ada 4 variabel promosi yang dapat dilakukan antara lain :
        1. Priklanan,
        2. Personal selling,
        3. Promosi penjualan,
        4. Publisitas
        d. Tempat
        Dalam rangka melancarkan arus barang dan jasa dari produsen ke konsumen maka faktor yang perlu diperhatikan adalah masalah saluran tempat pendistribusian, cakupan besar, pengelompokkan lokasi dan persediaan transportasi. Saluran distribusi ini disebut juga saluran peragaan atau saluran pemasaran yang umumnya disebut suatu rute atau jalur.

        BAB 111
        METODE PENELITIAN
        3.1 Metode Pengumpulan Data
        Untuk memperoleh data dan informasi tentang masalah yang akan diteliti maka metode yang dipergunakan dalam penelitian ini adalah :
        a. Library Research (study kepustakaan)
        Dalam metode pengumpulan data ini dilakukan dengan cara mempelajari dan mengkaji berbagai topik yang akan diteliti, seperti literatur-literatur melalui perpustakaan, majalah, surat kabar dan laporan-laporan.
        b. Field Research
        Merupakan suatu cara pengumpulan data dan informasi langsung dari sumber dilapangan untuk memperoleh data primer melalui wawancara terhadap pihak-pihak yang dianggap dapat memberikan informasi yang relevan dan dengan cara pengamatan serta observasi secara langsung pada perumahan aston villa jambi.
        • Wawancara
        Dalam hal ini penulis melakukan pengumpulan datadengan melakukan wawancara langsung terhadap pimpinan perusahaandan bagian pemasaran serta pihak-pihak yang berwenang terhadap data yang diproleh.
        • Observasi
        Teknik pengumpulan data yang dilakukan dengan melakukan pengamatan terhadap objek penelitian dalam rangka memperoleh data sekunder yang diperlukan dengan menggunakan observasi langsung.

        3.2 jenis dan Sumber Data
        adapun jenis data yang dipergunakan dalam penelitian ini adalah sebagai berikut :
        1. Data primer merupakan data yang didapat dari sumber pertama yaitu berdasrkan hasil wawancara dengan pimpinan dan karyawan bagian pemasaran perumahan aston villa jambi.
        2. Data sekrnder merupakan data prime yang telah diolah lebih lanjut. Dat sekunder yangmeliputi :
        a. Jenis produk,
        b. Perkembangan jumlah tenaga kerja perusahaan,
        c. Struktur organisasi perusahaan,
        d. Keadaan karyawan pada perusahaan.
        Sedangkan sumber data yang digunakan dalam penelitian ini berasalkan dari : perumahan aston villa jambi
        3.3 Metode Analisis
        Metode analisi data yang digunakan dalam penelitian ini adalah analisis deskriftif. Menurut Mohd Nasir (1998;29) analisis deskriftif adalah menganalisa terhadap perkembangan data-data yang ada dan mencoba membandingkan dengan konsep dan prinsip-prinsip yang relevan dengan masalah penelitian.

        salam pak jo……
        ini proposal tentatif saya dgn judul “analisis strategi pemasaran pada penjualan rumah toko di perumahan aston villa jambi”
        bagimana menurut bapak? apa ada yang perlu saya perbaiki? tolong berikan komentarnya pak…….

        Komentar oleh novita kurniawati | Januari 14, 2012

  17. TUGAS I (INDIVIDU)
    NAMA : NURFADLI
    NIM : C1B009040
    KELAS : MGT ‘A’ 09

    JUDUL : Analisis Pengaruh Pemulihan Layanan Terhadap Keluhan pelanggan Dan Kegagalan Layanan Dalam Rangka Meningkatkan Kepuasan Pelanggan

    Nur, ini kasusnya dimana. Kalau saya sarankan ambil pada salah satu pelayanan publik bisa pelanggan speedy, listrik, askes dll. Judulnya tak usah pakai kegagalan, tapi analisis pemulihan. Kalau menggunakan pemulihan berarti meneliti apa yg dilakukan oleh organisasi, apakah berjalan atau tidak. Ini dapat dilanjutkan.

    Komentar oleh NurFadli | Desember 13, 2011 | Balas

    • terimakasih pak sarannya, saya akan memperbaiki judulnya

      Komentar oleh NurFadli | Desember 14, 2011 | Balas

      • ini judul yang saya perbaiki pak
        ” ANALISIS PEMULIHAN LAYANAN TERHADAP KELUHAN PELANGGAN ASKES DALAM RANGKA MENINGKATKAN KEPUASAN PELANGGAN ASKES

        Komentar oleh NURFADLI | Januari 5, 2012

      • ini perubahan judul yang lebih di sederhanakan pak
        ” Analisis Pemulihan layanan Pelanggang Askes di Kota Jambi ”

        Fadli, ditunggu proposal tentatifmu.

        Komentar oleh NurFadli | Januari 7, 2012

      • BAB I

        PENDAHULUAN

        1.1 Latar Belakang

        ASKES merupakan Pelayanan publik merupakan tanggung jawab pemerintah dan dilaksanakan oleh instansi pemerintah, baik itu di pusat, di Daerah, dan dilingkungan Badan Usaha Milik Negara. Pelayanan publik berbentuk pelayanan barang publik maupun pelayanan jasa.
        Dewasa ini Masyarakat semakin terbuka dalam memberikan kritik bagi pelayanan publik. Oleh sebab itu substansi administrasi sangat berperan dalam mengatur dan mengarahkan seluruh kegiatan organisasi pelayanan dalam mencapai tujuan.

        Salah satu bentuk pelayanan publik yang dilaksanakan oleh pemerintah adalah pemenuhan kebutuhan kesehatan masyarakat. Reformasi dibidang kesehatan dilaksanakan untuk meningkatkan pelayanan kesehatan dan menjadikannya lebih efisien, efektif serta dapat dijangkau oleh seluruh lapisan masyarakat. Seperti yang tertuang dalam Keputusan Menteri Kesehatan Republik Indonesia No. 951/Menkes/SK/VI/2000 yaitu bahwa “tujuan pembangunan kesehatan adalah untuk meningkatkan kesadaran, kemauan dan kemampuan hidup sehat bagi setiap orang agar terwujud derajat kesehatan masyarakat yang optimal”.

        Dengan meningkatnya tingkat pendidikan dan keadaan sosial dalam masyarakat maka, meningkat pula kesadaran akan arti hidup sehat dan keadaaan tersebut menyebabkan tuntutan masyarakat akan pelayanan kesehatan yang bermutu, nyaman dan berorientasi pada kepuasan konsumen semakin mendesak dimana diperlukan kinerja pelayanan yang tinggi.

        Adapaun proses pelayanan kesehatan dan kualitas pelayanan berkaitan dengan ketersediaan sarana kesehatan yang terdiri dari pelayanan kesehatan dasar (Puskesmas, Balai Pengobatan), pelayanan rujukan (rumah sakit), ketersediaan tenaga kesehatan, peralatan dan obat-obatan.

        Kinerja pelayanan menyangkut hasil pekerjaan, kecepatan kerja, pekerjaan yang dilakukan sesuai dengan harapan pelanngan, dan ketepatan waktu dalam menyelesaikan pekerjaan.

        Pemerintah telah berusaha memenuhi kebutuhan masyarakat akan pelayanan kesehatan dengan mendirikan Rumah Sakit dan Pusat Kesehatan Masyarakat (PUSKESMAS) di seluruh wilayah Indonesia. Puskesmas adalah unit pelaksana teknis dinas kesehatan.

        Namun, sampai saat ini usaha pemerintah dalam memenuhi kebutuhan masyarakat akan kesehatan masih belum dapat memenuhi harapan masyarakat. Banyak anggota masyarakat yang mengeluh dan merasa tidak puas dengan pelayanan yang diberikan oleh Puskesmas terutama pada pengguna ASKES milik pemerintah ini baik itu dari segi pemeriksaan yang kurang diperhatikan oleh petugas kesehatan, lama waktu pelayanan, keterampilan petugas, sarana/fasilitas, serta waktu tunggu untuk mendapatkan pelayanan.

        Pusat Kesehatan Masyarakat (PUSKESMAS) sebagai salah satu sarana kesehatan yang memberikan pelayanan kesehatan kepada masyarakat memiliki peran yang sangat strategis dalam mempercepat peningkatan derajat kesehatan masyarakat. Oleh karena itu Puskesmas dituntut untuk memberikan pelayanan yang bermutu yang memuaskan bagi pasiennya sesuai dengan standar yang ditetapkan dan dapat menjangkau seluruh lapisan masyarakatnya.

        Salah satu keluhan yang sering terdengar dari masyarakat yang berhubungan dengan aparatur pemerintah adalah selain berbelit–belit akibat birokrasi yang kaku, perilaku oknum aparatur yang kadang kala kurang bersahabat, juga kinerja pegawai dalam memberikan pelayanan dalam hal ini ketepatan waktu dalam memberikan pelayanan, kuantitas dan kualitas pelayanan yang masih sangat rendah.

        Rendahnya kinerja pelayanan akan membangun citra buruk pada Puskesmas, dimana pasien yang merasa tidak puas akan menceritakan kepada rekan-rekannya. Begitu juga sebaliknya, semakin tinggi kinerja pelayanan yang diberikan akan menjadi nilai plus bagi Puskesmas, dalam hal ini pasien akan merasa puas terhadap pelayanan yang diberikan oleh Puskesmas.

        Puskesmas dapat mengetahui kinerja pelayanan dari para pasien melalui umpan balik yang diberikan pasien kepada Puskesmas tersebut sehingga dapat menjadi masukan untuk peningkatan kinerja pelayanan. memuaskan bagi pasien melalui upaya kesehatan. Perlu adanya pelayanan yang baik yang diberikan oleh pegawai oleh sebab itu dituntut kinerja yang tinggi dari pegawai. Kinerja pelayanan pada Puskesmas di Kota Jambi masih belum sesuai dengan keinginan masyarakat karena masih seringnya terdengar keluhan pasien maupun keluarganya dimana masih seringnya pegawai Puskesmas yang lambat dalam memberikan pelayanan, pasien sering menunggu lama untuk mendapatkan giliran dilayanani oleh pegawai. Oleh karena itu, saya tertarik untuk melakukan penelitian dengan memilih judul ” Analisis Pemulihan Layanan Pelanggan Askes di Kota Jambi ”

        1.2 Rumusan Masalah
        Kepuasan adalah salah satu aspek penilaian terhadap mutu pelayanan kesehatan yang mempunyai arti penting bagi masyarakat dalam menentukan perilaku kesehatan berikutnya. Maka dari itu diperlukan suatu informasi yang menjelaskan sejauh mana kepuasan pasien ASKES pada pelayanan kesehatan di kota jambi. Bertolak dari latar belakang di atas, maka yang menjadi permasalahan yang akan dibahas yaitu Bagaimana Kinerja Pelayanan Pelanggan Askes di Kota Jambi dilihat dari segi Kuantitas, Kualitas, dan Ketepatan Waktu.

        1.3 Tujuan Penelitian
        Sesuai dengan pokok permasalahan yang ada, tujuan penelitian ini yaitu untuk menggambarkan kinerja pelayanan Askes di Kota Jambi, baik dari segi kuantitas, kualitas, dan ketepatan waktu penyelesaian pekerjaan.

        1.4 Manfaat penelitian
        Manfaat dalam peneliti ini mengarah kepada aspek berikut :
        1. Akademis
        Memberikan informasi kepada masyarakat mengenai tingkat kinerja pelayanan ASKES.
        2. Praktis
        Secara praktis penelitian ini bermanfaat untuk memberikan masukan kepada pelayanan ASKES. Dalam hal ini pihak manajemen organisasi atau perusahaan tentang pandangan masyarakat terhadap kinerja pelayanan selama ini sehingga pelayan publik dapat memperbaiki atau meningkatkan kinerja pelayanan sesuai dengan harapan masyarakat.

        BAB II
        METODE PENELITIAN

        2.1 Populasi dan Sampel

        2.1.1 Populasi

        Populasi adalah keseluruhan dari objekpenulisan yang dapat terdiri dari manusia, tumbuh-tumbuhan, hewan, benda-benda, gejala-gejala, nilai atau peristiwa sebagai sumber datayang memiliki karakter tertentu dalam suatu penelitian (Nawawi,1990).
        Adapun yang menjadi populasi dalam penelitian ini adalah rata-rata jumlah pengguna ASKES (Asuransi Kesehatan) yang menerima pelayanan kesehatan di Pusat Kesehatan Masyarakat ( PUSKESMAS). dikota Jambi
        terutama yang berada di kawasan Selincah Jambi Timur
        Tabel
        Jumlah pelanggan ASKES yang berobat di PUSKESMAS Selincah
        No Bulan Jumlah pasien
        2010 Jumlah pasien
        2011
        1
        2
        3
        4
        5
        6 April
        Mei
        Juni
        Juli
        Agustus
        September 70
        63
        76
        59
        73
        42 86
        74
        77
        62
        86
        90
        JUMLAH 383 475
        Sumber :PUSKESMAS Selincah

        2.1.2 Sampel

        Sample adalah suatu bagian dari populasiyang akan di teliti yang di anggap dapat menggambarkan populasi (soerhatono 2004). Pada penelitian ini jumlah sample tidak dapat di hitung dengan pasti. Hal ini dikarenakan yang menjadi sampel adalah pasien yang menggunakan kartu Asuransi Kesehatan di Puskesmas Payo Selincah yang tiap hari dan bulannya tidak bisa dipastikan jumlahnya.

        Pasien yang menggunakan ASKES ( Asuransi Kesehatan) di Kota jambi tidak dapat dipastikan berapa banyaknya menggunakan kartu Askes tersebut. Dapat kita lihat dari tabel diatas pada tahun 2010 dari bulan april sampai september masyarakat yang berobat berjumlah 383 dan pada tahun 2011 dari april sampai september berjumlah 475. Jadi rata-rata pasien yang berobat adalah 63 orang untuk tahun 2010 dan rata-rata tahun 2011 yang berobat adalah 79 orang yang berkunjung ke Puskesmas setiap bulannya.

        Adapun teknik pengambilan sampel yang dilakukan oleh peneliti ini adalah dengan teknik purposive sampling, yaitu penentuan sampel dilakukan dengan sengaja. Dalam hal ini, yang akan menjadi sampel dalam penelitian adalah pelanggan Askes yang ingin mendapatkan layanan terbaik yang akan menjadi suatu kepuasan bagi pelanggan Askes.

        Daftar Pustaka

        Keputusan Menteri Kesehatan Republik Indonesia No. 951/Menkes/SK/VI/2000
        Aswar, Asrul. 1995. Menjaga Mutu Pelayanan Kesehatan : Aplikasi Prinsip lingkaran pemecahan masalah. Pustaka sinar harapan
        Word Health Organization. 1992. Pendidikan Kesehatan. Penerbit ITB. Bandung
        Pengertian Sample (soerhatono 2004)
        Data Puskesmas Selincah

        Komentar oleh NurFadli | Januari 12, 2012

  18. Nama : Rachmat Putra Chayadri
    Nim : ERC1B009069
    Kelas Ekstensi Sore

    JUDUL : PENGARUH CITRA MINIMARKET TERHADAP LOYALITAS PELANGGAN
    PADA MINIMARKET TUNAS HARAPAN JAYA.

    Rahmat, citra itu terbentuk lama. Saya tak tahu sudah berapa lama mini market yg akan dteliti ini. Hal ini perlu, karena bila ingin meneliti citra harus dapat ditunjukkan berapa lama sudah objek penelitian diamati. Dalam penulisan latar belakang anda harus jelaskanter dahulu.

    Komentar oleh rachmat | Desember 13, 2011 | Balas

    • iya pak,jadi judul yang saya ajukan ini apa bisa di lanjutkan pak,,?kemudian penulisan latar belakang harus jelaskanter dahulu itu yang bagai mana pak,,?mohon solusinya.. terimakasih pak jo…

      LAta belakang harus dimulai dg penjeasan peran Mini Market dan bagaimana kinerja Minimarket yg diamati sehingga anda bisa menyimpulkan citra dalam pelayanan dimaksud.

      Komentar oleh rachmat | Desember 14, 2011 | Balas

  19. iya pak jo…terimakasih

    Komentar oleh rachmat | Desember 15, 2011 | Balas

  20. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL : “ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI KONSUMEN DALAM PENGAMBILAN KEPUTUSAN PEMBELIAN PRODUK MIE INSTAN MEREK INDOMIE”

    Rahmat, cari judul lain ya. Setidaknya membuat pembaca tertarik. Judul diatas mengulang-ulang yg sudah pernah ada, cuma beda produk saja tuh.

    Komentar oleh RAHMAT | Desember 16, 2011 | Balas

  21. Nama : GAMALIEL FERNANDEZ S
    NIM : C1B009009

    JUDUL : “Analisis strategi bersaing warnet(warung internet) di Mendalo”

    Judul ini menarik, tapi konsep yg digunakan harus jelas. Bisa menggunakan konsep pendekatan pelanggan sebgaimana dalam manajemen pemasaran stratejik. Temukan berbagai atribut yg menentukan pelanggan menggunakan Internet, baru rumuskan penelitiannya. Silahkan membuat proposal tentatifnya. Mulai dg latar belakang.

    Komentar oleh gamaliel fernandez | Desember 16, 2011 | Balas

    • ya, thanks pak jo…
      maaf lama balasnya pak.. hhe :)

      Komentar oleh gamaliel fernandez | Januari 5, 2012 | Balas

      • PENDAHULUAN

        1.1 Latar Belakang
        Dalam dunia usaha, banyak dan bertambahnya perusahaan yang menghasilkan produk atau jasa yang sejenis akan menimbulkan persaingan yang memaksa suatu perusahaan melakukan upaya-upya untuk mempertahankan pelanggannya. Jika tidak maka pelanggan-pelanggannya akan beralih ke perusahaan lain atau membeli produk dan jasa lain. Hanya perusaan yang mampu menyesuaikan dengan keaadan lingukngan yang mampu bertahan dan mampu mengembangkan usahannya. Suatu perusahaan bisnis harus mampu memilih strategi yang tepat untuk perusahaan tersebut. Untuk itu perusahaan harus mampu merumuskan dan menjalankan strategi bersaingnya sebagai bagian dari strategi pemasaran
        Pemasaran adalah suatu salah satu dari fungsi operasional perusahaan. Fungsi pemasaran mempunyai kedudukan yang sangat penting diantara fungsi-fungsi bisnis yang kita ketahui yang terdiri dari fungsi keuangan, fungsi produksi, dan fungsi sumberdaya manusia.
        Fungsi pemasaran menduduki tempat yang penting karena di dalam fungsi ini terdapat suatu fungsi penting yaitu penjualan. Penjualan (selling) menghasilkan pendapatan (revenue) dan di dalam pendapatan itu tergantung laba rugi.
        Kelangsungan hidup perusahaan banyak ditentukan oleh sejauh mana perusahaan dapat melaksanaan kegiatan pemasarannya dengan efektif dan menghasilkan laba. Produksi atau jasa yang dihasilkan atau diedarkan tidak akan menghasilkan laba jika produk atau jasa itu tidak laku atau tidak terjual.
        Pada umumnya diketahui, bahwa tujuan perusahaan tidaklah semata-mata mencari laba. Ada tujuan-tujuan lain yang dikejarnya yaitu membina kesejahteraan karyawan, membantu masyarakat dan menjaga keselamatannya menguasai pasar serta memuaskan pelanggan.
        Agar dapat bersaing dengan baik dan efektif, suatu perusahaan harus menerapkan strategi yang tepat yang sesuai dengan kondisi persaingan yang dihadapinya.
        Perusahaan harusmemilikistrategibersaing yang berbedadengan yang dilakukanolehperusahaansaingan.Inidilakukan agar perusahaandapatbertahanhidupbahkanmemenangkanpersaingan.Strategi yang efektifadalahstrategi yang mendorongterciptanyasuatukeselarasan yang sempurnaantaraorganisasidenganlingkungannyadanantaraorganisasidenganpencapaiandaritujuanstrategisnya.
        Seiringdenganmeningkatnyakebutuhankita, perkembanganteknologimelajudenganpesat.Dalammemasuki era globalisasi, semakinbanyakteknologi yang dapatmempermudahmanusiadalammelakukanberbagaiaktivitaskehidupan.Kemajuandibidangtransportasi, komunikasi, kesehatan, pendidikan, danbidanglainnyamerupakanbeberapacontohbahwakitasemakinmemerlukanteknologidalamkehidupanini.Dengandemikian, tidakdiragukanlagiperananteknologidalamkehidupanmanusia.Saatini, duniatelahmengenalsuatuteknologi yang dinamakan internet.Melalui internet, semua orang dapatberkomunikasidengan orang lain yang berada di berbagaibelahandunia. Melalui media ini pula merekadapatmemperolehdanmenyampaikanberbagaiinformasi yang dibutuhkankapandandimanasaja.Denganadanyajaringanglobal, internet dapatdiakses 24 jam sehari. Begitumemerlukaninformasitertentu, dalamhitungandetikkitadapatmemperolehnyahanyadengancaramengakses internet. Dapatdibayangkanbetapabesarnyaperanan media internet dalamkehidupankitasehari-hari.Internet tidakhanyadapatdigunakandalammencariinformasisaja.Media internet jugadigunakanolehberbagaikalangandalammelakukanusahabisnisnyamelaluipembangunanSitussebagai media promositentangbisnis yang dijalankannya.Warnet (Warung Internet) merupakansalasatupeluangbisnis di sektorjasadenganpasarpotensial yang terusberkembang.KondisisepertiinidimanfaatkanolehpenyediajasaWarnet yang terletak di Jalan Jambi-MuaroBulian.Seiringdenganberjalannyawaktu, semakinbanyakWarnetlain yang bermunculan, sehinggamenyebabkanpersaingandibisnisinisemakinketat. Bahkansekaranginisudahada 20 warnet yang berada di MendalodisekitarkawasankampusUnjaMendalo, halberdampakterhadapberkurangnyapelanggan. Hal inimembuatparapenyediawarnetmembutuhkanstrategibisnis yang lebihinovatifdanefektif agar dapatmengatasitekananpadapersaingantersebut, bahkandiharapkandapatmengembangkanusahanyadenganlebihbesarlagi.

        Berikutinimerupakantabelnama-namawarnet yang ada di mendalo:
        Tabel 1.1
        Nama-namawarnet
        dimendalo
        No NamaWarnet
        1 Berkah Net
        2 BayoNet
        3 Gangga Net
        4 Sahabat Net
        5 Onek-onek
        6 Iin Net
        7 Eeng Net
        8 Zero Net
        9 Matras Net
        10 Global Net
        11 Dinni
        12 Athlon Net
        13 Padi Net
        14 7 Net
        15 3 Diva Net
        16 Faris
        17 Rasa Net
        18 The Bhobhojois net
        19 TubangGarla Net
        20 She Lima Net

        Penulisinginmenganalisisstrategibersaing yang bagaimana yang dapatdigunakanolehwarnetuntukmemaksimalkankekuatandanmemanfaatkanpeluang yang ada, sertameminimalkankelemahandanmenghindariancaman yang munculdalammenghadapipersaingandenganwarnetlainnya.Dengandemikianpenulismengambilsampeldari 5 warnet yang ada di mendalo, yaituberkah net, sahabat net, bayo net, rasa net dandinni.
        1.2 Perumusan Masalah
        Penulismerumuskanmasalahsebagaiberikut:
        “Apasajastrategibersaing yang bisadigunakanolehpenyediawarnetuntuklebihmeningkatkanposisinya?”

        1.3 Tujuan dan Manfaat Penelitian
        1.3.1 Tujuan penelitian
        Adapuntujuanpenelitianadalahuntuk:
        1. Menganalisisstrategiapa yang dapatdigunakanolehparapenyediawarnet yang ada di mendalo.

        1.3.2 Mafaat penelitian
        Manfaat yang diperoleh dengan melakukan penelitianini adalah :
        1. Dari sisi akademis
        sebagai tambahan acuan bagi para akademis yang ingin lebih memahami tentangkualitas jasa yang diberikan perusahaan dalammelakukan penjualan jasa.
        2. Dari sisi praktisi
        Penelitian ini diharapkan sebagai tambahan informasi dan sumbangan pikiran yangbermanfaat dalam membuat kebijakan dimasa yang akan datang.

        1.4 Ruang Lingkup Penelitian
        Penelitiandibatasipadastrategiapa yang dilakukanolehparapenyediawarnet di mendalountukmenarikpelanggan.

        Sampel

        Kebanyakandaripenyediawarnetmelakukanpenambahanfasilitasterhadapwarnetnyasertapeningkatanpelayananterhadappelanggannyauntukkenyamananparapelanggan, itulahstrategi yang dilakukanolehpenyediawarnet yang ada di mendalo.Berikutadalahsampel yang diambildaripenelitianterhadapwarnet-warnet yang ada di mendalo.

        No Namawarnet Hal yang diunggulkan
        1 Berkah Net • JasaLayananpengetikan, print/cetakfoto, penginstalan (computer dan laptop).
        • Fasilitas dispenser (air minum), kipasangin, gelas, toilet.
        2 Sahabat Net • Jasalayananpengetikan, print/cetakfoto, penginstalan (computer, laptop, aplikasi)
        • Fasilitaskipasangin, headset, toilet,
        3 Bayo Net • Jasalayananpengetikan, print/cetakfoto.
        • Fasilitaskipas angina, toilet, raksepatu.
        4 Rasa Net • Jasalayananpenjualan chip poker danpenjualan voucher gemscool.
        • Fasilitaskipasangin, dispenser, toilet
        5 Dinni • Jasalayananpengetikan, print/cetakfoto, danpenjualanalattulissertaminumandingin.
        • Fasilitas AC, toilet, danraksepatu

        Komentar oleh GAMALIEL FERNANDEZ | Januari 12, 2012

  22. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL : “PENGARUH PERSEPSI TENTANG PROMOSI TERHADAP KEPUTUSAN PEMBELIAN KONSUMEN PADA ABADI SWALAYAN”

    Rahmat, persepsi belum tentu melakukan pembelian. Persepsi dapat sebatas positif atau negatif, atau baik dan buruk. Judul ini potensial untuk dilanjutkan dg catatan anda dapat menjelaskan ragam promosi yg sedang dilakukan oleh Abadi Swalayan. Pendekatannya bauran promosi. Judul bisa jadi berubah, tapi topiknya tetap yaitu Bauran Promosi Abadi.

    Komentar oleh rahmat | Desember 17, 2011 | Balas

    • Pak bagaimana kalau judulnya saya ganti menjadi “Analisis Pengaruh Promosi Terhadap Keputusan Pembelian Konsumen Pada Abadi Swalayan”

      Komentar oleh rahmat | Desember 19, 2011 | Balas

      • Rahmat, judulmu banyak. Saya sarankan pakai judul” Pengaruh Persepsi atas Promosi Terhadap Keputusan Pembelian di Abadi Swalayan.

        Komentar oleh johannessimatupang | Januari 6, 2012

  23. Tugas 1 (INDIVIDU)
    NAMA : JONI HANTER.IMMANUEL
    NIM : ERCIB009066
    Kelas Ekstensi Sore

    JUDUL : 1.” ANALISIS KEPUASAN PELANGGAN TERHADAP KEPUASAN PRODUK PRINTER CANON.

    2.” analisis pengaruh promosi terhadap tingkat penjualan pada modem telkomsel flash”.

    Joni. Untukkasus printer Canon di FE rasanya belum ada. Anda boleh lanjuti kasus ini, tapi judulnya harus berubah. Misalnya dg meneliti faktor penentu kepuasan pengguna printer canon. Silahkan dilanjuti dg menyusun latar belakang. Kerja keras lagi. Pak. Jo.

    Komentar oleh joni hanter.immanuel | Desember 17, 2011 | Balas

  24. Nama : Remmy Dodo Jandelli
    NIM : ERC1B009070
    Kelas Ekstensi Sore

    JUDUL :
    1. PENGARUH CITRA HYPERMART JAMBI TERHADAP LOYALITAS PELANGGAN
    2. MOHON SARAN : Saya punya topik satu lagi yang memurut saya menarik pak, saya lagi mengamati kelebihan penggunaan Ibu-ibu sebagai tenaga penjual/sales…beberapa perusahaan sudah menerapkan strattegi ini..mau saya bandingkan dengan perusahaan yang mengunakan cewek-cewek cantik dan muda sebagai tenaga penjual..tapi saya terkendala sama judul, sumber data serta refrensi buku apa yang mesti saya gunakan…

    Terima kasih

    Remy poin dua lebih menarik, karena masih jarang topik seperti itu. Untuk tenaga penjual ibu-ibu tentu punya keunggulan, karena mereka memutuskan proses pembelian. Silahkan ambil kasusmu, untuk produk apa dan mulai menulis latar belakang.

    Komentar oleh Remmy Dodo Jandelli | Desember 18, 2011 | Balas

    • Thank pak jo, kalo saya kerucutkan lagi menjadi ANALISA STRATEGI PENGGUNAAN “LADY YAKULT” SEBAGAI TENAGA PENJUAL…mohon batuan judul yang pas untuk topik saya ini pak…terima kasih…

      Komentar oleh Remmy Dodo Jandelli | Desember 18, 2011 | Balas

  25. TUGAS I (INDIVIDU)
    NAMA : FERRY ANGRIAWAN
    NIM : ERC1B009032
    Kelas extensi siang

    JUDUL:
    “ANALISIS PERSEPSI MINAT KONSUMEN TERHADAP BONUS SUATU PRODUK DALAM PEMASARAN PADA PRODUK GATSBY SHOWER GEL”

    Komentar oleh ferry angriawan | Desember 20, 2011 | Balas

    • Maaf,pak jo..
      Saya mau mnanyakan..bgaimana judul sya d atas..,sy sudah kirm dr 3 hari yg lalu,.tp blum ad komntar.trima kasih pak.

      Ferry kalau ada konfirmasi judul, tuliskan ulang judul yg anda maksud sehingga tidak harus mencari lagi.

      Komentar oleh ferry | Desember 22, 2011 | Balas

      • Y pak trma kasih
        Ini pak.. Judul yg saya maksud;

        JUDUL:

        “ANALISIS PERSEPSI MINAT
        KONSUMEN TERHADAP BONUS
        SUATU PRODUK DALAM
        PEMASARAN PADA PRODUK
        GATSBY SHOWER GEL”

        Komentar oleh ferry | Desember 22, 2011

  26. Nama:DEWI CHRISTINA
    Nim: ERC1B009027
    Kelas sore manajemen.
    “ANALISIS PENGARUH KEBIJAKAN HARGA, DAN FASILITAS PENDUKUNG TERHADAP KEPUASAN PELANGGAN DI HOTEL PUNDI JAMBI”

    Komentar oleh DEWI CHRISTINA | Desember 20, 2011 | Balas

  27. NAMA: STELLA ANDELINA
    NIM: ERC1B009027
    JUDUL SKRIPSI : “PENGARUH POTONGAN HARGA TERHADAP OMSET PENJUALAN PADA PRODUK TUPPERWARE DI KOTA JAMBI”

    Komentar oleh STELLA ANDELINA | Desember 20, 2011 | Balas

    • NAMA: STELLA ANDELINA
      NIM: ERC1B009017
      kelas sore manajemen
      JUDUL SKRIPSI : “PENGARUH POTONGAN HARGA TERHADAP OMSET PENJUALAN PADA PRODUK TUPPERWARE DI KOTA JAMBI”

      Komentar oleh Stella | Desember 20, 2011 | Balas

  28. NAMA: PUTRI AMALIA
    NIM : ERC1B009040
    kelas sore manajemen
    JUDUL SKRIPSI : “PENGARUH KUALITAS PELAYANAN TERHADAP KEPUASAN PASIEN RS.BUDI GRAHA KOTA JAMBI”

    Komentar oleh Putri Amalia | Desember 20, 2011 | Balas

  29. NAMA; INDAH INTAN SARI
    NIM: ERC1B009080
    kelas sore manajemen
    JUDUL SKRIPSI: “PENGARUH MODEL IKLAN KOSMETIK PIXY TERHADAP KONSUMEN DALAM PEMBELIAN PRODUK PIXY DI KOTA JAMBI”

    Komentar oleh Indah Intan Sari | Desember 20, 2011 | Balas

  30. “ANALISIS BAURAN PEMASARAN TERHADAP PENJUALAN PADA DEALER SEPEDA MOTOR SUZUKI DI KOTA JAMBI ”

    Ricky kalau topik ini ingin dilanjuti, gunakan analisis promosi penjualan. Promosi penjualan apa saja yg dilakkan oleh dealer yang membuat orang mau melakukan pembelian. SIlahkan dilanjuti.

    Komentar oleh Ricky Ikhwansyah | Desember 20, 2011 | Balas

    • selamat malam pak,
      saya ada satu pilihan judul lagi yang menurut saya menarik untuk saya tindak lanjuti..

      judulnya:
      “Analisis Kepuasan Nasabah Terhadap Pelayanan PT. Asuransi Sinar Mas Cabang Jambi”.

      mohon komentarnya pak. terimakasih

      Ricky segera susun proposal tentatifmu. Judul diatas bisa dilanjuti. Tapi yg harus diingat kamu harus bisa tunjukkan penelitian dilakukan dimana, lokasi penelitian harus jelas.

      Komentar oleh Rickyikhwansyah@ymail.com | Januari 9, 2012 | Balas

      • iya pak,,
        segera saya susun untuk proposal tentatifnya. Untuk penelitian masih dalam wilayah jambi dan penelitian tertuju pada kepuasan nasabah pada PT.Asuransi Sinar Mas Cabang Jambi.

        Komentar oleh Rickyikhwansyah@ymail.com | Januari 10, 2012

      • selamat pagi pak
        nama: Ricky Ikhwansyah (Kelas Sore)
        nim : ERC1B009026

        ini saya ada alternatif judul yang lain pak selain judul yang saya kirim sebelumnya pada pak jo..
        “MENGANALISA FAKTOR YANG MEMPENGARUHI PERILAKU KONSUMEN DALAM MEMBELI HELM MEREK KYT”

        judul ini hanya alternatif saja pak, kira-kira kalau menurut pak jo judul yg saya maksudkan menarik.. mohon diberikan komentar pak. terimakasih.

        Komentar oleh Ricky Ikhwansyah | Januari 12, 2012

  31. Mlam pak,sya Herleni ank smstr5 klas siang.

    Komentar oleh HERLENI ERCIBOO9055 | Desember 20, 2011 | Balas

  32. NAMA : WAHYU AFERO
    NIM : ERC1B009013
    Manajemen
    kelas extensi siang
    JUDUL : “PENGARUH CITRA TOKO TERHADAP MINAT BELI KONSUMEN PADA TOKO BUKU ASTIKA”

    Wahyu, temukan judul yg lebih tepat untuk dapat diteliti. Toko buku masih terlal kecil untuk dilakuan analisis citra oleh karena itu, perbaiki judul. Atau temukan dulu bidang yg sesuai dg minat dan masalah yg anda temui. Kerja keras lagi.

    Komentar oleh wahyu afero | Desember 20, 2011 | Balas

  33. Nama: HERLENI
    NIM : ERC1B009055
    Manajemen

    JuduL: “Analisis Pemasaran Penjualan Perumahan ‘ARGENTINA RESIDENCE’ PT.DARMA WANGSA ABADI (DWA).

    Herleni, judul dg kata analisis pemasaran masih terlalu luas. Karenanya temukan hal yg spesifik dari terminologi pemasaran. Misalnya saja tentang promosi penjualan yg dilakukan pengembang sehingga pelanggan dapat segera melakukan pembelian. Segera perbaiki judul dan buat proposal tentatif. Pak. Jo.

    Komentar oleh HERLENI ERCIBOO9055 | Desember 20, 2011 | Balas

    • iya pak,,sya boleh lanjut dgn judul nie krn sya sngat mnyukai pemasaran perumahan ini.,mnurt bpk mnganalis sngat luas tpi sya rubah sdikt judulny to pemasaranny ni.sya mngambl judul ni krn sya bsa lngsung mneliti perumahan Argentina yg ad d mayang…gmna mnurut bpk,,???

      Komentar oleh HERLENI ERCIBOO9055 | Desember 21, 2011 | Balas

      • Pak,ini judul bru sya

        “Promosi Penjualan Perumahan Argentina Residence Jambi”

        Komentar oleh HERLENI ERCIBOO9055 | Januari 13, 2012

      • Judul :” Promosi Penjualan Perumahan Argentina Residence Jambi”

        BAB1
        PENDAHULUAN
        1.1.Latar Belakang

        JAMBI-Tingginya jumlah pengajuan kepemilikan rumah yang masuk ke meja PT Darma Wangsa Abadi(DWA),selaku pengembang perumahan Argentina Residence,memacu pihaknya untuk terus memberikan pelayanan terbaik bagi konsumennya,di antaranya dengan mempertahankan kualitas rumah yang sedang dibangun untuk penghuninya.
        Oleh karena itu,menyoal pengadaan fasilitas utama,perusahaanyang digawangi Darma Wijaya ini tidak pernah menomorduakan hal itu.Sampai-sampai tidak jarang sang Direktur Utama mengecek langsung tentang kualitas barang,dari mulai material bangunan hingga fasilitas pendukung yang akan digunakan di dalam pembangunan unit rumah.

        “Dalam garapan proyek perumahan Argentina Residence,DWA selalu menempatkan penyediaan fasilitas air bersih dan listrik dalam daftar pekerjaan utama yang wajib dbereskan.penyediaan air bersih yang tidak terbatas dan aliran listrik yang memadai merupakan daya jual perumahan Argentina Residence,”tandas Roni Satria Budi,Leader Marketing PT DWA saat ditemui kemaren.

        Selain unggul di fasilitas air dan listrik,hunian real estate minimalis di tengah kota yang berlokasi dijalan Multatuli,Simpang Mayang Puskes,Mayang Mangurai ini,juga memiliki segudang keistimewaan baik dalam segi rancangan bangunan,spesifikasi bangunan dan material yang digunakan,maupun sederet fasilitas pendukung yang melekat di Perumahan Argentina Residence.

        Soal tampilan bangunan rumah,Argentina sangat memikat dengan desain minimalis modern namun tetap mengakomodir kebutuhan penghuninya. Dari tampilan luar,detail bangunan Argentina yang berpadu dengan unsur warna yang elegan sangat sesuai dengan selera masyarakat modern.

        Tidak hanya tampak luar yang keren,Unit rumah DWA juga dibangun dengan menerpkan standar spesifikasi bangunan yang handal,cermat dan kuat.Pondasinya telah menggunakan batu bata serta sloof beton bertulang.Sementara pada dindingnya,DWA menyelesaikannya dengan pelesteran aci serta cat.Tentu,penerapan spesifikasi ini akan menambah daya kokoh tembok bangunan.

        Di bagian atap rumah,Argentina telah menggunakan genteng keramik M-class serta rangka atap kayu meranti.Ada pun plafondnya terbuat dari gysum.Dengan perpaduan itu,atap rumah dipastikan akan mampu bertahan lama.
        Sedangkan untuk perkusenan jendela dan pintu, DWA memasang kayu bulian yang sudah terkenal kuat dan tidak mudah keropos.Di bagian lantai,keramik pilihan telah disediakan yang diserasikan dengan warna rumah.”Semua yang kita pasang serta gunakan merupakan material pilihan yang telah teruji ketahanannya dan mengikuti estitika rancang bangunan yang mengikuti selera pasar,”Ujar Roni

        Di bagian kamar mandi,DWA telah menempatkan perabotan kelas nomor satu dikelasnya.Sebut saja closet dan fitting american standard.Dengan begitu,Sudah tergambarkan secara jelas bahwa hunian yang dihasilkan DWA ini mampu menciptakan prestise tersendiri dikalangan penghuninya.

        Sebagai informasisampai saat ini unit rumah Argentina yang telah terserap mencapai 40 persen dari 185 unit.Dari 40 persen itu,30 unit telah diserahterimakan kepada penghuninya lengkap beserta fasilitasnya,seperti air dan listrik.”Dari data ini juga bisa diambil kesimpulan bahwa pembangunan unit rumah oleh DWA yang telah berjalan 1tahun 4bulan,lebih cepat dari yang disepakati yakni kurang lebih 8bulan dari waktu yang disepakati yaitu 12bulan dari tanggal kesepakatan jual beli,”Ujar Juni Marketing Leader DWA di waktu yang bersamaan.

        Ihwal keunggulan,selain pada fasilitas utama air dan lisrtik,hunian real estate minimalis ditengah kota yang terdiri dari tipe 47/90 deret,47/120 kopel,50/120 kopel,65/120 kopel,74/120 deret dan 74/150 kopel tersebut,memiliki seabrek keistimewaan baik dalam segi rancangan bangunan,materi bangunan yang dipakainya maupun sederet fasilitas pendukung yang melekat di Perumahan Argentina Residence.
        Saat ini DWA menyuguhkan penawaran special,yaitu diskon 10 persen,besaran uang muka 10 persen,bunga KPR yang hanya 9,25 persen dan penawaran potongan cicilan bulanan.

        1.2. Perumusan masalah

        Melonjaknya keinginan masyarakat untuk memiliki rumah di Argentina yang berlokasi dijalan Multatuli,Simpang Mayang Puskes,Mayang Mangurai ini,menurut Roni,disebabkan semakin tumbuhnya kepercayaan konsumen serta melihat langsung bukti unit rumah beserta fasilitas yang telah dibangun perusahan milik Darma Wijaya ini.

        Soal tampilan bangunan rumah,Argentina sangat memikat dengan desain minimalis modern namun tetap mengakomodir kebutuhan penghuninya.Dari tampilan luar,detail bangunan Argentina yang telah berpadu dengan unsur warna yang elegan sangat sesui dengan selera masyarakat modern.Selain unggulan di fasilitas air dan listrik,hunian real estate minimalis ditengah kota yang berlokasi dijalan Multatuli,Simpang Mayang Puskes,juga memiliki segudang keistimewaan baik dalam segi rancang bangunan,spesifikasi bangunan dan material yang digunakan,maupun sederet fasilitas pendukung yang melekat di Perumahan Argentina Residence.

        Tidak hanya tampak luar yang keren,unit rumah DWA juga dibangun dengan menerapkan standar spesifikasi bangunan yang handal,Pondasinya telah menggunakan batu bata serta sloof beton bertulang.sementara pada dindingnya,DWA menyelesaikannya dengan pemelesteran aci serta cat,penerapan spesifikasi ini akan menambah daya kokoh tembok bangunan.
        Di bagian atap rumah,Argentina telah menggunakan genteng keramik M-class serta rangkap atap kayu meranti.Adapun plafondnya terbuat dari gypsum.Dengan perpaduan itu,atap rumah dipastikan akan mampu bertahan lama.Maka Penulis tertarik untuk melakukan penelitian mengenai”Promosi Penjualan Perumahan Argentina Residence Jambi”

        1.3. Tujuan dan Manfaat Penelitian

        1.3.1 Tujuan

        Tujuan dari penelitian ini adalah sebagai berikut:
        a.Untuk memperoleh gambaran tentang Promosi Penjualan Perumahan Argentina Residence Jambi
        b.Untuk mengenal pengaruh Promosi Penjualan Perumahan Argentina Residence Jambi

        1.3.2. Manfaat
        Adapun manfaat dari penelitian ini adalah berikut:
        d.Untuk menambah wawasan dan pengetahuan penulis tentang Promosi Penjualan Perumahan Argentina Residence Jambi.
        e.Sebagai bahan masukan bagi PT.DARMA WANGSA ABADI(DWA)

        1.4.Ruang lingkup penelitian
        Untuk memberi batasan yang jelas penelitian ini,maka penulis menetapkan ruang lingkup penelitian sebagai berikut :

        a.Penelitian ini dibatasi hanya dalam bidang Manajemen Pemasaran
        b.Aspek yang diteliti adalah Promosi Penjualan Perumahan Argentina Residence Jambi
        c.Yang menjadi objek peneliti adalah Promosi Penjualan Perumahan Argentina Residence Jambi.

        BAB II
        TINJAUAN PUSTAKA

        2.1. Landasan Teoritis
        2.1.1.Definisi-definisi

        1.Manajemen

        Banyak pendapat yang mengemukakan definisi tentang manajemen salah satu diantara Alex.S Nitisemito (1996 : 2 ) Mengemukakan bahwa ‘Manajemen adalah ilmu seni dan seni untuk mencapai tujuan melalui kegiatan orang lain”.
        pengertian lain di utarakan oleh Malaya S.P Hasibuan (2000:9) yakni:”manajemen adalah ilmu seni mengatur proses pemanfaatan sumber daya manusia dan sumberb daya lainnya dengan bantuan orang lain untuk mencapai tujuan”.

        2.Manajemen Pemasaran

        Menurut Edwin B.Flippo ( Malaya S.P Hasibuan 2000:11) Manajemen pemasaran adalah Perencanaan,pengarahan,dan pengendalian dari pengadaan pengembang,kompensasi,pengintegrasian,dan pemberhentian karyawan dengan maksud terwujudnya tujuan perusahan,individu,karyawan dan masyarakat.

        2.2. Kerangka Teoritis

        Pemasaran merupakan asset utama dan terpenting bagi suatu konsumen,karena pemasaran selalu berperan aktif dalam setiap kegiatan pemasaran,yaitu sebagai perencanaan dan pengendalian jalannya pemasaran dalam pencapaian tujuan.setiap perusahaan apapun bentuknya senantiasa berupaya mencapai tujuan secara efektif dan efisien,dengan cara mengoptimalkan pemasaran yang dimiliki disertai dengan memberikan dorongan dan kebutuhan-kebutuhan konsumen,sehingga tetap tinggi agar tujuannya tercapai.

        BAB III
        METODE PENELITIAN

        3.1.Metode Penelitian

        Untuk memperoleh data yang diperlukan dalam penelitian ini,penulis menggunakan metode pengumpulan data sebagai berikut :

        a.Studi kepustakaan
        Melalui studi kepustakaan ini penulis mempelajari teori-teori,dokumen-dokumen resmi,peraturan-peraturan yang berkaitan dengan masalah Pemasaran.

        b.Penelitian Lapangan
        Penelitian ini dimaksud untuk mendapat data primer yakni data yang diperoleh dan dikumpulkan dari jawaban Quisioner pegawai PT DARMA WANGSA ABADI JAMBI digunakan sebagai bahan analisis.metode pengumpulan data ini dilakukan dengan :

        1.Wawancara (Interview)
        Wawancara dilakukan untuk memperoleh informasi yang benar dari sumber yang tepat dan kompeten yaitu pejabat PT DARMA WANGSA ABADI Jambi.

        3.2.Jenis dan sumber Data
        Adapun jenis data yang digunakan adalah data primer dan skunder meliputi kurun waktu 2tahun, Sedangkan sumber data berasal dari:

        a.Data Primer
        Data Primer adalah data yang diperoleh langsung dari objek penelitian, yaitu dari jawaban responden terhadap faktor-faktor yang mempengaruhi Promosi Penjualan Perumahan Argentina Residence Jambi.

        b. Data Skunder
        Data skunder adalah data yang dikumpulkan dari objek penelitian meliputi data absensi pegawai yang memperoleh langsung dari PT DWA Jambi.

        3.3. Sampel
        Sampel dalam penelitian ini adalah seluruh pegawai PT DWA Jambi yang berjumlah 55 Orang.

        DAFTAR PUSTAKA

        Cardos Gomes,faustino (1995),Manajemen Pemasaran,yogyakarta
        Google.Argentina Residence Jambi.com
        Flippo, Edwin b(2000),Manajemen Pemasaran Terjemahan oleh Hasibuan,malayu S.P,jakarta: PT Bumi Aksara

        Bertha, judulmu dtrategi pemasaran, akan tetapi pada tujuan penelitian ternyata promosi penjualan. Kenapa tak pakai promosi penjualan saja. Populasi dan sampelmu juga belum pas. KEnapa sumber informasi adalah pegawai, bukan konsumen?

        Komentar oleh Bertha moricha | Januari 25, 2012

  34. Nama : DEDY SUDARMADI
    NIM : ERC1B009057
    Manajemen ekstensi sore..

    Judul : Analisa kesenjangan harga pangan ikan nila terhadap harga jual setelah panen, dikota jambi.

    Dedy ini judul dekat dg pertanian, kenapa tak temukan judul di bidang manajemen?

    Komentar oleh DEDY SUDARMADI | Desember 20, 2011 | Balas

    • begitu ya pak, ok pak saya coba cari judul lain, makasi saranya pak

      Komentar oleh DEDY SUDARMADI | Desember 20, 2011 | Balas

  35. TUGAS 1 (Individu)
    Nama : Marhamah
    Nim : ERC1B009061
    Kelas : ekstensi siang
    Judul : “ PERANAN MARKETING MIX DALAM MENINGKATKAN VOLUME PENJUALAN MOBIL PADA PT MEGA GEMILANG MOTOR ”

    Gemilang motor itu dealer apa penjual motor bekas? Lantas pertimbangkan pula konsep bauran pemasaran sebagai alat karena sifatnya terlalu luas. Silahkan diperbaiki.

    Komentar oleh MARHAMAH | Desember 20, 2011 | Balas

    • Baik pak… Makasiih saranny pak :)

      Komentar oleh MARHAMAH | Desember 21, 2011 | Balas

  36. TUGAS INDIVIDU
    NAMA: STELLA ANDELINA
    NIM: ERC1B009017
    JUDUL SKRIPSI : “PENGARUH POTONGAN HARGA TERHADAP OMSET PENJUALAN PADA PRODUK TUPPERWARE DI KOTA JAMBI”

    Komentar oleh STELLA ANDELINA | Desember 21, 2011 | Balas

  37. Nama:DEWI CHRISTINA
    Nim: ERC1B009027
    Kelas sore manajemen.
    “ANALISIS PENGARUH KEBIJAKAN HARGA, DAN FASILITAS PENDUKUNG TERHADAP KEPUASAN PELANGGAN DI HOTEL PUNDI JAMBI

    Judulnya terlalu luas, kalau hendak menggunakan satu variabel gunakan mana yg lebih signifikan. Misalnya, Kebijakan harga, promosi penjualan dll. Kerja keras lagi, siapkan proposal tentatif.

    Komentar oleh DEWI CRISTHINA | Desember 21, 2011 | Balas

  38. NAMA: PUTRI AMALIA
    NIM : ERC1B009040
    kelas sore manajemen
    JUDUL SKRIPSI : “PENGARUH KUALITAS PELAYANAN TERHADAP KEPUASAN PASIEN RS.BUDI GRAHA KOTA JAMBI”

    Hal yg harus diperjelas adalah atribut pelayanan. Silahkan rumuskan baru siapkan proposal tentatifnya.

    Komentar oleh Putri Amalia | Desember 21, 2011 | Balas

    • Nama : Putri Amalia
      Nim : ERC1B009041

      Trimakasih pak ,,

      Komentar oleh Putri Amalia | Desember 22, 2011 | Balas

  39. NAMA; INDAH INTAN SARI
    NIM: ERC1B009080
    kelas sore manajemen
    JUDUL SKRIPSI: “PENGARUH MODEL IKLAN KOSMETIK PIXY TERHADAP KONSUMEN DALAM PEMBELIAN PRODUK PIXY DI KOTA JAMBI”

    Komentar oleh Indah Intan Sari | Desember 21, 2011 | Balas

  40. Nama: Marhamah
    Nim: ERC1B009061
    Salam pak jo :)
    Saya ada satu lg judul yg mau saya ajukan, mengenai pengaruh makelar dalam penjualan mobil bekas di mega gemilang motor, saya bingung pak, judul yang pas yang apa ya pak?? Dan apakah bagus untuk di jadikan judul proposal nantinya..?
    Mohon sarannya ya pak, trima kasih ya pak

    Komentar oleh MARHAMAH | Desember 21, 2011 | Balas

  41. TUGAS INDIVIDU
    NAMA: LIDYA ANASTASIA
    NIM: ERC1B009020
    JUDUL SKRIPSI: PENGARUH IKLAN DAN SALURAN DISTRIBUSI TERHADAP PERUSAHAAN DEALER HONDA

    Judulmu terlalu luas, buat sedemikian rupa sehingga dapat diteliti dg baik.

    Komentar oleh LIDYA ANASTASIA | Desember 21, 2011 | Balas

  42. NAMA : SINGGIH PAMBUDI
    NIM : ERC1B009006
    kelas sore manajemen
    JUDUL SKRIPSI : ANALISIS PENGARUH HARAPAN PELANGGAN,KUALITAS PRODUK, KEPUASAN PELANGGAN TERHADAP LOYALITAS PELANGGAN INTERNET FLASH UNLIMITED DI KOTA JAMBI

    Singgih bidang penelitianmu ok, tapi judul perlu diperbaiki misalnya dg membuat judul Analisis Loyalitas pelanggan Internet Flash Unllimited di Kota Jambi. Agar lebih opersional misalnya ambil satu kecamatan saja. Silahkan buat lagi latar belakang sampai selesai proposal tentatif.

    Komentar oleh SINGGIH PAMBUDI | Desember 21, 2011 | Balas

    • salam pak jo
      jadi judul saya ANALISIS LOYALITAS PELANGGAN INTERNET FLASH UNLIMITED DI KOTA JAMBI ya pak ??
      mohon sarannya pak

      Komentar oleh singgih pambudi | Januari 24, 2012 | Balas

  43. NAMA : HARI SETIAWAN
    NIM : ERC1B009011
    Kelas sore manajemen
    JUDUL SKRIPSI : PERANAN PERIKLANAN DALAM MENINGKATKAN VOLUME PENJUALAN PADA PT. SINAR MAS

    Hari judulmu ini terlalu luas, SInar Mas itu korporasi, pilih salah satu produknya.

    Komentar oleh HARI SETIAWAN | Desember 21, 2011 | Balas

    • maaf pak jo bagaimana jika judul saya diganti dengan yang ini
      PERANAN PERIKLANAN DALAM MENINGKATKAN VOLUME PENJUALAN KELAPA SAWIT PADA PT. SINAR MAS
      bagaimana pendapat bapak ??

      Sinar Mas mengolah CPO jadi Minyak goren dll. Kalau tetap ingin meneliti produk kelapa sawit pilih saja produk minya goreng dari sawit. Misalnya, faktor apa yg menentukan seseorang memilih merek minyak goren tertentu.

      Komentar oleh Hari setiawan | Desember 22, 2011 | Balas

      • salam pak jo,.
        jadi judul penelitian saya ini bagai mana pak?
        apa harus di rubah atau tetap dengan judul ini?
        mohon saran nya pak….

        HAri kalau ingin saya menelaah judulmu, tuliskan di halaman ini sehingga saya tidak mencari-cari judul yg dimaksud. Begitu salah satu cara berkomunikasi.

        Komentar oleh Hari setiawan | Januari 24, 2012

  44. Nama : Bertha morischa
    Nim : ERC1B009k067

    Judul : ” Pengaruh Kualitas pelayanan terhadap kepuasaan konsumen pada Hotel Ratu Jambi ”

    Bertha, judul ini sudah ada cari yg lain ya.

    Komentar oleh Bertha moricha | Desember 21, 2011 | Balas

    • Judul : “Pengaruh Telor asin bagi konsumen daerah Jambi”

      Berhta kamu jurusan manajemen, jangan ajukan telor asin. Cari dan temukan masalah yg lebih berisikan kasus manajemen.

      Komentar oleh Bertha moricha | Desember 21, 2011 | Balas

      • brrti sya hruz gnti jdul lg y pak???

        Judul:”Pengaruh diskon pada produk kosmetik oriflame”
        gmn mnurut bpak bsa judul ini krn ini mnyangkut pemasaran.

        Bidang Oriflame belum banyak diteliti, tapi pastikan dulu apakan diskon menjadi sesuat yg begitu penting dalam pembelian kosmetika. Pertimbangkan faktor lain seperti Reference, WoM dll. Ini bisa dilanjutkan.

        Komentar oleh Bertha moricha | Desember 21, 2011

      • Apa yang dmaksud bpak WOM ?
        Berta, WoM itu Word of Mouth. Banyak membaca sehingga bisa mencari topik-topik baru dalam penulisan Skripsi.
        Jangan lupa menuliskan NIM dan Kelas pagi atau Sore.

        Komentar oleh Bertha moricha | Desember 29, 2011

      • Nama:Bertha Morischa
        Nim :ERC1B009067
        KLs sore

        Iya pak Mksih

        Komentar oleh Bertha moricha | Desember 29, 2011

      • Nama :bertha morischa
        Nim:ERC1B009067

        JUDUL:Pengaruh diskon pada produk kosmotik oriflame

        BAB I
        PENDAHULUAN
        1.1 Latar Belakang
        Perkembangan zaman bukanlah hal yang harus menghilangkan tradisi yang sudah melekat di dalam masyarakat. Kemajuan merupakan hasil kreatifitas manusia sebagai makhluk berpikir dan bertindak dalam mengembangkan potensi yang dimiliki. Hasil dari kreatifitas juga harus dapat menjaga tradisi yang ada sebelumnya. Karena merupakan upaya kreatifitas para pendahulu kita. Meninggalkan tradisi sebelumnya justru dapat membuat kita kehilangan jati diri atau identitas yang sebenarnya. Persatnya perubahan menuntut masyarakat mengubah pola hidup menyesuaikan dengan zaman, yang sering kita lalai pada jati diri kita sendiri.
        Kemajuan social ekonomi yang begitu pesat terlebih dengan masuknya budaya barat, membuat masyarakat Indonesia terlebih masyarakat Jambi semakin gencar berbelanja terlebih pada produk produk yang diskon.
        Banyak faktor yang mempengaruhi perilaku konsumen dalam menentukan pilihan yang akan dibeli dan dikonsumsi, sehingga perusahan oriflame dapat mengetahui perilaku konsumen yang merupakan cerminan alasan seseorang konsumen membeli suatu produk.
        Yaitu dengan cara memamerkan keunggulan dan kemewahan produk-produk oriflame.Sudah terkenal sejak 40 tahun yang lalu. Kandungan dalam Produk kosmetik oriflame terinspirasi oleh kermurnian dan khasiat alam dari Swedia ini terbuat dari bahan-bahan alami serta ramah lingkungan.formula oriflamme dikembangkan dengan teknologi terkini dan di produksi untuk memenuhi standar kualitas tertinggi. Dengan menggunakan produk oriflame, kita bisa merasakan perawatan mewah dari ujung rambut sampai ujung kaki dengan harga yang terjangkau. Produk oriflame, secara umum, terbagi atas empat kategori yaitu Tata Rias, Perawatan Kulit, Toiletries, Men’s Corner dan Wewangian.

        Rangkaian produk tata rias oriflame sangat lengkap. Giordani Gold adalah koleksi make up yang menawarkan kemewahan emas dalam foundation, bedak, lipstik, blush one hingga eye shadow. Untuk pilihan yang lebih ringan dan ceria ada rangkaian produk yang ditujukan untuk kelompok umur berbeda. Ada pula produk make up Savannah (oriflame limited edition) yang akan memberikan tampilan smokey sempurna pada riasan wajah anda.

        Time reversing collection merupakan produk unggulan Oriflame untuk wanita 45+ yang peduli dengan perawatan kulit mereka. Produk oriflame ini mengandung B-Prostimuline Complex yang membantu memperlambat efek penuaan hormonal.

        Rasakan sensansi kecantikan abadi di wewangian produk oriflame Petal Quartz. Bayangkan bau kelopak bunga mawar yang sensasional dalan satu kali semprotan di kulit anda. Para wanita pasti merasa istimewa ketika memakai produk wewangian ini. Ada pula koleksi wewangian oriflame lain seperti Sensoria, Enigma, Precious, dan Volare. Sedangkan untuk pria, produk kesegaran Glacier Oriflame patut dicoba. Campuran wangi apel, bergamot, dan tangerine berpadu sempurna dengan kesegaran lemon grass. Hhmmmm….pasti membuat anda tambah percaya diri.
        Dengan banyak nya pilihan produk oriflame maka konsumen memiliki berbagai jenis pilihan produk yang mereka sukai.
        Di setiap tahun produk oriflame memberikan penawaran lebih baik .diskon lebih besar dan peluang lebih banyak agar konsumen tertarik untuk membeli nya.
        Berdasarkan latar belakang diatas maka penulis bermaksud mengadakan penelitian dengan judul “Pengaruh Diskon Pada Produk Kosmetik Oriflame di kota jambi”.

        1.2 Rumusan masalah
        Berdasarkan latar belakang masalah tersebut diatas, peneliti mencoba mengidentifikasi permasalahan sebagai berikut :
        1.2.1 Bagaimana pengaruh diskon produk oriflame terhadap konsumen Indonesia terutama konsumen Jambi? 1.2.2 Seberapa besar pengaruh diskon produk oriflame terhadap konsumen jambi
        1.3 Tujuan Penelitian
        1.3.1 Untuk mengetahui pengaruh diskon produk oriflamme konsumen Indonesia terutama konsumen jambi 1.3.2 Agar konsumen tertarik untuk membeli produk Oriflame dan meningkatkan penjualan
        1.4 Manfaat penelitian
        1.4.1 Konsumen bisa membeli sebuah produk dengan harga lebih murah dibanding saat produk tidak diskon. 1.4.2 Dapat memberikan wawasan kepada pembaca tentang besarnya pengaruh diskon terhadap keputusan pembelian produk oriflamme.

        Bab 2.
        METODE PENELITIAN
        Untuk memperoleh data yang di perlukan dalam penelitian ini penulis menggunakan metode pengumpulan data sebagai berikut:
        1.Obyek / Populasi Penelitian
        Dalam penulisan skripsi ini yang menjadi obyek penelitian adalah Konsumen oriflame Jambi yang melakukan order oriflamme ke Stokis oriflame BLK (Balai latihan Tenaga kerja). Sedangkan subyek/populasi dari penelitian ini adalah konsumen oriflame dengan jumlah populasi sebanyak 500. orang pada tahun 2011. Dasar dalam pengambilan populasi ini adalah perbedaan konsumen berbelanja pada harga diskon dan harga normal (seperti saat hari raya dan bulan natal) dimana pada bulan ini sering dilakukan diskon besar-besaran. Pengambilan datanya hasil dari wawancara langsung bersama pihak konsumen oriflame dengan mengambil rata-rata pembelanja dengan harga normal sekitar 50 orang dan pada bulan dengan tawaran harga khusus sekitar 100 orang. Hal ini yang mengakibatkan jumlah pembeli membengkak dua kali lipat.
        2.Sampel
        Sampel dalam penelitian ini adalah konsumen oriflame yang berjumlah sekitar 50 orang.
        3.Jenis dan sumber data
        Ada dua jenis data yang di gunakan data primer dan skunder,sedang kan sumber berasal dari:
        a.Data primer adalah data yang di peroleh langsung dari objek penelitian yaitu dari jawaban responden terhadap penjualan oriflame.
        b.Data skunder adalah data yang dapat dikumpulkan objek penelitian meliputi banyak nya orderan konsumen oriflame saat produk sedang diskon.
        DAFTAR PUSTAKA
        Kotler, philip. 2005. Manajemen Pemasaran. Jakarta: Indeks
        Setiadi, J. Nugroho. 2003. Perilaku Konsumen. Jakarta: Prenada Media
        http://www.google.com
        http://www.oriflame.com

        Komentar oleh bertha morischa | Januari 27, 2012

  45. TUGAS INDIVIDU
    NAMA: STELLA ANDELINA
    NIM: ERC1B009017
    Kelas sore manajemen
    JUDUL SKRIPSI : “PENGARUH POTONGAN HARGA TERHADAP OMSET PENJUALAN PADA PRODUK TUPPERWARE DI KOTA JAMBI”

    Komentar oleh STELLA ANDELINA | Desember 21, 2011 | Balas

  46. TUGAS INDIVIDU
    NAMA : INDAH INTAN SARI
    NIM : ERC1B009080
    Kelas Ekstensi Siang
    JUDUL SKRIPSI : ” PENGARUH FUNGSI MERK TERHADAP RESPON KONSUMEN DALAM PEMBELIAN SUATU PRODUK “

    Komentar oleh INDAH INTAN SARI | Desember 21, 2011 | Balas

  47. TUGAS INDIVIDU
    NAMA: STELLA ANDELINA
    NIM: ERC1B009017
    Kelas sore manajemen
    JUDUL SKRIPSI : “PENGARUH POTONGAN HARGA TERHADAP OMSET PENJUALAN PADA PRODUK TUPPERWARE DI KOTA JAMBI”

    Komentar oleh Indah Intan Sari | Desember 21, 2011 | Balas

  48. NAMA :STELLA ANDELINA
    NIM :ERC1B009017
    KELAS SORE MANAJEMEN

    JUDUL SKRIPSI : PENGARUH BAURAN PROMOSI TERHADAP PENINGKATAN VOLUME PENJUALAN PRODUK PADA PT.YAMAHA.SABANG RAYA MOTOR JAMBI

    Stella berapa judul yg kamu ajukan.

    Komentar oleh STELLA ANDELINA | Desember 21, 2011 | Balas

    • maaf pak sebenarnya saya ajukan 1 judul ,”pengaruh potongan harga terhadap omset penjualan pada produk tupperware di kota jambi “.
      tetapi tidak bapak komentari maka nya saya kirim 2 judul lagi ,mohon sarannya pak terimah kasih pak

      Stella, Tupperware apa benar melakukan potongan harga? Objekmu boleh tupperware, tapi cari judul lain.

      Komentar oleh STELLA ANDELINA | Desember 22, 2011 | Balas

      • judul lain yang saya ajukan :Analisis Pengaruh Diferensiasi Produk tupperware Terhadap Kepuasan Konsumen di kota jambi

        Komentar oleh STELLA ANDELINA | Desember 23, 2011

      • judul lain yang saya ajukan :Analisis Pengaruh Diferensiasi Produk tupperware Terhadap Kepuasan Konsumen di kota jambi

        Komentar oleh STELLA ANDELINA | Desember 25, 2011

      • Stella, kamu sudah boleh menulis proposal tentatif.

        Komentar oleh johannessimatupang | Desember 26, 2011

  49. NAMA :STELLA ANDELINA
    NIM :ERC1B009017
    KELAS SORE MANAJEMEN

    judul skripsi : “pengaruh kualitas pelayanan terhadap loyalitas pasien pada puskesmas simpang IV sipin kota jambi”

    Judul seperti ini sudah banyak dibuat, kalau mau mempertahankan topik yg sama cari variabel yg berbeda, jangan kualitas dan loyalitas. PErbaiki segera.

    Komentar oleh STELLA ANDELINA | Desember 21, 2011 | Balas

  50. TUGAS I (INDIVIDU)
    NAMA : Marissa Husna
    NIM : ERC1B009015
    Kelas ekstensi siang

    judul : analisis kualitas jasa pd divisi gangguan PT. PLN cbg kota jmbi

    Komentar oleh Marissa Husna ERC1B009015 | Desember 22, 2011 | Balas

  51. TUGAS I (INDIVIDU)
    NAMA : NANDA REGEN
    NIM : C1B008137
    MGT G’08

    judul :
    “Analisis Factor Factor Kesejahteraan pekerja Industri Rumah Tangga (Batu Bata) Di Setiti Muaro Jambi”

    Manda judul ini cenderung bukankajian Manajemen, temukan judul lain.

    Komentar oleh NANDA REGEN | Desember 22, 2011 | Balas

    • maaf sbelumnya pak jo yg saya maksud kan adalah judul yang ini pak….
      “Analisis strategi pemasran terhadap peningkatan penjualan batu bata disetiti muaro jambi”

      Silahkan lanjuti dg penulisan proposal tentatif.

      Komentar oleh nanda regen | Desember 27, 2011 | Balas

      • sekarang bagai mana menurut pak jo…?????
        tolong pak di beri komentar……!!!!!

        Nanda, orang pemasaran jangan cari batu bata sebagai objek lah, cari produk lain. Misalnya atap multiroof, atap yg dapat meredam bunyi hujan dll.

        Komentar oleh nanda regen | Desember 27, 2011

      • Maaf pak kalau judul nya saya rubah menjadi

        “Analisis Strategi pemasaran terhadap peningkatan penjualan gas elpiji 3 kilo pada PT carpotama putra perkasa jambi”

        bagai mana pak…???

        Komentar oleh nanda regen | Januari 4, 2012

      • Pak ini judul yang sya ajukan bagaimana menurut pak jo….???
        untuk mengganti judul yang di atas….
        mohon saran nya pak……
        “Analisis persepsi masyarakat terhadap penggunaan Gas elpiji 3kg di karya maju telanai pura “

        Komentar oleh Nanda regen | Januari 13, 2012

  52. TUGAS INDIVIDU

    NAMA : FREDY FRISTAMA
    NIM : ERC1B009060
    KELAS SORE MANAJEMEN

    JUDUL SKRIPSI : “Pengaruh pelaksanaan advertising yang efektif untuk meningkatkan volume penjualan pada hotel Abadi”

    Komentar oleh Fredy Fristama | Desember 22, 2011 | Balas

  53. TUGAS I (INDIVIDU)
    NAMA : FERRY ANGRIAWAN
    NIM : ERC1B009032
    Kelas extensi siang
    JUDUL:
    “ANALISIS PERSEPSI MINAT
    KONSUMEN TERHADAP BONUS
    SUATU PRODUK DALAM
    PEMASARAN PADA PRODUK
    GATSBY SHOWER GEL DIKOTA JAMBI”

    Ferry judulmu ini terlalu banyak variabel, persepsi minat, bonus menjadi suilit menentukan mana yg independen. Pilih salah satu saja variabel yg akan dijadikan peneltiian.

    Komentar oleh ferry angriawan | Desember 22, 2011 | Balas

    • Iya pak,. Kalau saya persempit jadi

      JUDUL :
      ANALISIS PENGARUH BONUS TERHADAP TINGKAT PEMBELIAN PADA PRODUK GATSBY SHOWER GEL DIKOTA JAMBI.

      Mohon sarannya pak,.

      Komentar oleh ferry | Desember 27, 2011 | Balas

  54. TUGAS I (INDIVIDU)
    NAMA : DALLES MARTENSA
    NIM. : C1B008124
    MGT G 08

    JUDUL : MENGANALISA FAKTOR YANG MEMPENGARUHI
    PERILAKU KONSUMEN DALAM MEMBELI HELM MEREK KYT DI KOTA JAMBI

    Dalles, baca majalah Swa edisi kemarin. KYT merupakan merek tersohor 2011. Saya sarankan anda mengambil brand image, pengaruh brand image dalam pembelian Helem KYT. Saya tunggu proposal tentatif.

    Komentar oleh DALLES MARTENSA | Desember 23, 2011 | Balas

    • iya pak terima kasih sarannya pak :)

      Komentar oleh DALLES MARTENSA | Januari 15, 2012 | Balas

  55. TUGAS I (INDIVIDU)
    NAMA : FIRDAUS
    NIM : C1B009150
    MGT G ’09

    judul :
    ” ANALISIS STRATEGI PEMASARAN PAKAIAN DI DISTRO THE ZOMBIE JAMBI ”

    Firdaus judul strategi terlalu luas, gunakan judul lebih sempit misalnya Analisis Personal Sellingnya, karena personal selling lebih besar perannya dalam mengelola Distro.

    Komentar oleh Firdaus | Desember 23, 2011 | Balas

    • iya pak terima kasih sarannya :)
      ini judulnya pak yang baru :

      “ANALISIS PERSONALSELLING PAKAIAN MEREK STARCROSS PADA DISTRO THE ZOMBIE JAMBI”

      Komentar oleh Firdaus | Januari 17, 2012 | Balas

      • BAB I
        PENDAHULUAN

        1.1 Latar Belakang Masalah
        Globalisasi disegala bidang sudah terjadi dan berpengaruh secara langsung terhadap kondisi Indonesia yang meliputi bidang politik, ekonomi, pendidikan, teknologi dan bahkan bidang sosial budaya. Dari berbagai bidang Indonesia banyak tertinggal dengan negara-negara di kawasan Asia Tenggara sendiri. Dalam hal ini kemajuan suatu negara diikuti oleh pemasaran produk dan jasa pada perekonomian nasional. Semakin maju suatu negara, maka kesejahteraan masyarakatnya semakin meningkat.
        Dalam menghadapi era globalisasi, bangsa indonesia siap bersaing dan berbenah diri, guna untuk mengejar ketertinggalan dari negara lain. Sejalan dengan kemajuan dan perkembangan industri ditentukan dengan sumber daya manusia yang handal dan terampil untuk menghadapi pesatnya persaingan industri. Dalam hal ini pemerintah membuat kebijakan yang berdampak positif terhadap industri menengah, agar nantinya bisa terbuka peluang pasar sehingga industri–industri yang ada di indonesia terus berkembang dan mampu berdaya saing.
        Perusahaan yang bergerak di bidang industri masa kini harus memikirkan kembali misi bisnis dan strategi pemasaran mereka secara keritis, hal ini perlu karena banyaknya perusahaan yang bersaing secara tidak sehat, seharusnya mereka bersaing dengan ketentuan etika bisnis dan undang-undang yang berlaku. Kebijaksanaan pemasaran yang terkelola dengan baik akan meningkatkan kesetiaan pelanggan dan penjualan berhasil ditingkatkan. Salah satunya dengan meningkatkan produk yang inovatif dan ditambah dengan dukungan iklan-iklan, baik itu media cetak maupun elektronik .
        Usaha kecil dan menengah merupakan sektor yang sangat menunjang dan sering dijadikan sebagai indikator keberhasilan pembangunan suatu daerah. Usaha kecil dan menengah adalah sektor yang menguasai hajat hidup orang banyak, baik itu usaha yang kecil maupun usaha kecil yang telah berkembang menjadi sebuah usaha yang besar. Karena setiap keberhasilan serta perkembangannya dapat menentukan taraf hidup masyarakat. Salah satu UKM (Usaha Kecil dan Menengah) yang sedang berkembang saat di Propinsi Jambi , tepatnya di Kota Jambi yaitu usaha yang menjual pakaian (Distro) berupa bermacam jenis pakaian yang biasanya dibutuhkan oleh masyarakat sebagai kebutuhan sandang, karena pakaian adalah kebutuhan pokok yang harus dipenuhi setalah kebutuhan pangan.
        Dari awal mulanya produk yang dijual adalah dalam jumlah merek yang relatif kecil, Kemudian terus berkembang menjual produk berbagai jenis merek yang ada dari berbagai industri pakaian. Adapun usaha kecil menengah dalam penelitian pada tugas akhir ini adalah Distro The Zombie. Dalam usaha kecil dan menengah kita mengenal ada beberapa kegiatan salah satunya pada strategi pemasaran. Strategi pemasaran merupakan salah satu faktor penting yaitu sebagai kegiatan peningkatan efesiensi penjualan sehingga semakin banyak pesanan dari konsumen yang akhir penjualan bisa meningkat, sehingga usaha akan terus berkembang.
        Berdasarkan uraian diatas maka judul tugas akhir ini adalah “ANALISIS PERSONAL SELLING PAKAIAN MEREK STARCROSS DISTRO THE ZOMBIE JAMBI”.

        1.2 Batasan Masalah
        Mengingat luasnya cakupan masalah yang ada pada usaha distro The Zombie, untuk itulah adanya batasan masalah agar nantinya lebih terarah dalam penulisan tugas akhir ini, adupun batasan masalahnya yaitu mengenai strategi pemasaran pakaian merek starcross yang telah diterapkan oleh distro The Zombie Jambi.

        1.3 Rumusan Masalah
        Berdasarkan latar belakang dan batasan masalah yang dikemukakan diatas adapun rumusan masalahnya adalah:
        a. Strategi pemasaran apa saja yang telah diterapkan distro The Zombie dalam memasarkan produk pakaian merek starcross ?
        b. Seberapa besar market share produk pakaian merek starcross pada distro The Zombie untuk wilayah Kota Jambi ?

        1.4 Tujuan Penelitian
        Adapun yang menjadi tujuan penelitian dari penyusunan tugas akhir ini adalah:
        a. Untuk mengetahui strategi pemasaran apa saja yang telah diterapkan pada distro The Zombie dalam memasarkan produk pakaian merek starcross.
        b. Untuk mengetahui besarnya market share produk pakaian merek starcross untuk wilayah Kota Jambi yang telah dicapai oleh distro The Zombie bila dibandingkan dengan distro lain yang sejenis.

        1.5 Manfaat Penelitian
        Manfaat yang dapat diperoleh dari penelitian ini adalah:
        a. Untuk menambah pengetahuan dan wawasan terutama yang berkaitan dengan strategi pemasaran.
        b. Dengan adanya penelitian ini dapat mengetahui bagaimana cara penjualan produk pakaian merek starcross.
        c. Sebagai bahan informasi kepada distro The Zombie dan bagi para pembaca mengenai strategi pemasaran.

        Komentar oleh Firdaus | Januari 17, 2012

      • BAB II
        TINJAUAN PUSTAKA

        2.1 Pengertian Pemasaran
        Pemasaran adalah suatu proses manajeral yang membuat individu atau kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan dan mempertukarkan produk yang bernilai kepada pihak lain atau segala kegiatan yang menyangkut penyampaian produk atau jasa mulai dari produsen sampai konsumen.
        Pemasaran merupakan salah satu dari kegiatan pokok yang dilakukan oleh para pengusaha dalam usaha untuk mempertahankan kalansungan hidup perusahaan, untuk berkembang dan mendapatkan laba. Berhasilnya dalam tujuan bisnis tergantung keahlian mereka di bidang pemasaran, produksi, keuangan maupun di bidang lainya. Pemasaran adalah sistem keseluruhan dari kegiatan usaha yang ditunjukan untuk merencanakan, menentukan harga, mempromosikan, dan mendistribusikan barang dan jasa yang dapat memuaskan kebutuhan pembeli yang ada maupun pembeli yang potensial (willian,1999).
        Sejumlah orang berpikir tentang pemasaran sebagaian menemukan pelanggan yang cukup banyak atas out put perusahaan, konsumen mempunyai tingkatan akan produk yang didambakan. Pada suatu saat bisa terjadi permintaan yang memadai atau terlalu banyak permintaan dan manajemen pemasaran harus menemukan cara untuk menghadapi semua permintaan konsumen yang berbeda.
        Pengertian pemasaran menurut beberapa parah ahli pemasaran yaitu:
        1. Pemasaran adalah suatu sistem total dan kegiatan bisnis yang dirancang untuk merencanakan, menentukan harga, mendistribusikan dan mempromosikan barang-harang yang dapat memuaskan keinginan dan jasa baik kepada para konsumen saat ini maupun konsumen potensial (Tanton,1996).
        2. Pemasaran adalah suatu proses sosial yang didalamnya individu dan kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan dan secara bebas mempertukarkan produk yang bernilai dengan pihak lain (Kotler,1999).
        Jadi pemasaran mencakup usaha dari perusahaan yang dimulai dari mengindentifikasi kebutuhan para konsumen yang perlu dipuaskan, menentukan produk yang mana hendak diproduksi, menentukan harga jual dan menentukan promosi yang tepat dan sesuai dengan jenis produk yang dipasarkan dan juga menentukan penyaluran yang seuai dari produk tersebut. Ini dilakukan oleh semua perusahaan, karena kepuasan konsumen merupakan salah satu jalan untuk mendapatkan laba guna mempertahankan kelansungan hidup perusahaannya untuk memasarkan produk. Untuk dapat melakukan kegiatan pemasaran melalui beberapa proses yang disebut proses pemasaran. Adapun yang disebut dengan proses pemasaran tersebut adalah pengumpulan, pengimbangan dan penyebaran.
        1. Yang dimaksud dengan pengumpulan
        Dalam pengumpulan ini lembga-lembaga pemasaran mengumpulkan barang-barang yang ada pada mulanya terdiri atas bahagian yang kecil dari berbagai produksi menjadi jumlah yang lebih besar.
        2. Yang dimaksud dengan pengimbangan
        Setelah lembaga pemasaran mengumpulkan barang-barang tersebut, kemudian dilakukan proses berikutnya yaitu membungkus atau pengepakan ke dalam ukuran tertentu, dan kemudian disimpan di gudang. Setelah itu lembaga-lembaga pemasaran mengadakan keseimbangan antara demand dan suplay.
        3. Yang dimaksud dengan penyebaran.
        Proses ini merupakan proses teakhir dari pemasaran, dengan menyebarkan barang yang akan dipasarkan kepada pedagang eceran. Dengan demikian para konsumen akan lebih mudah mendapatkan barang yang diinginkan.

        2.2 Strategi Pemasaran
        2.2.1 Pengertian Strategi Pemasaran
        Strategi pemasaran merupakan logika yang dilaksanakan dengan harapan unit bisnis dapat mencapai sasaran pemasaran. Strategi pemasaran menyajikan pendekatan pemasaran yang luas yang akan digunakan untuk mencapai tujuan (kotler,1997). Tujuan strategi pemasaran untuk mendapatkan calon pembeli, untuk meningkatkan jumlah pelanggan dan untuk memenangkan persaingan.
        Strategi pemasaran adalah suatu cara yang digunakan untuk dapat membantu kita membuat dan menjual barang dan jasa yang sesuai dengan kondisi perusahaan dan pasar sasaran atau selera konsumen yang dituju. Untuk mencapai sasaran yang dituju, maka harus ditetapkan suatu strategi pemasaran dalam menghadapi pesaingan, strategi pemasaran dapat diklasifikasikan ke dalam 4 bentuk (Philip kotler,1995):
        1. Strategi pemimpin pasar (Market Leader)
        Dimana suatu perusahaan diakui oleh industri yang bersangkutan sebagai pemimpin yang memiliki pangsa pasar besar ≥ 30 %, lebih unggul dari perusahaan lain dan merupakan pusat orientasi para pesaing. Biasanya perusahaan-perusahaan lain mengikuti tindakan-tindakan perusahaan dalam hal perubahan harga, pengenalan produk baru, pencakupan saluran distribusi, dan intensitas promosi. Perusahaan ini menjadi titik pusat orientasi para pesaing dan merupakan perusahaan yang ditantang, ditiru, atau dijauhi. Kehidupan pemimpin pasar sungguh tidaklah mudah, terkecuali bila perusahaan itu memang memiliki promosi resmi. Perusahaan tersebut senantiasa mempertinggi kewaspadaannya sebab para pesaingnya selalu mencari dan mencoba memanfaatkan kelemahannya, meski sekecil apapun. Perusahaan yang dominan selalu ingin tetap menjadi nomor satu. Mengembangkan pasar keseluruhan, hal ini dapat dilakukan dengan cara:
        a. Mencari konsumen baru dengan cara strategi penerobosan pasar, strategi pasar baru, dan strategi perluasan geografis
        b. Mencari dan mengenalkan kegunaan baru suatu produk
        c. Meyakinkan masyarakat konsumen agar menggunakan produk lebih banyak pada setiap kesempatan.
        d. Melindungi bagian-bagian pasar yang telah dikuasai dan mencoba memperkuat pasar. Perusahaan yang dominan tetap harus melindungi usahanya secara terus menerus dari serangan saingan-saingannya, untuk itu yang harus dikerjakan oleh perusahaan pemimpin dalam mempertahankan daerah kekuasaannya adalah inovasi (Pembaharuan ) yang terus menerus.
        e. Meningkatkan bagian pasar, selain mencari konsumen baru pada pasar yang baru, perusahaan juga dapat meningkatkan jumlah konsumen pada bagian pasar yang sudah dikuasai.

        2. Strategi penantang pasar ( Market challengger)
        Karakter penantang pasar biasanya dipandang menurut volume penjualan pangsa pasarnya ≥ 20 %, selalu mencari kelemahan pemimpin pasar, dan selalu melakukan tindakan untuk menggambil alih penjualan produk dari perusahaan-perusahaan lemah. Mereka dapat menyerang market leader dan pesaing-pesaing lainnya dalam suatu usaha yang gencar merebut bagian pasar, perusahaan inilah yang disebut market challanger dan mereka yang bersikap asal menerima tidak menggoncangkan pasar, disebut juga market follower. Beberapa strategi penyerangan yang bisa digunakan oleh market challanger :
        a. Menetapkan sasaran strategi lawan
        Langkah awal yang harus dilakukan oleh penantang pasar adalah menetapkan sasaran strategi dan memilih lawan yang dihadapi, untuk itu perusahaan harus melakukan analisis persaingan yang sistematis. Sasaran strategi dari kebanyakan penantang pasar adalah peningkatan bagian pasar dengan harapan akan menghasilkan profitabilitas yang lebih tinggi. Pada dasarnya, market challanger dapat memilih salah satu dari tiga jenis perusahaan yang dapat diserang yaitu pimpinan pasar, perusahaan-perusahaan yang sama besarnya tetapi kurang berhasil serta kekurangan dana, dan perusahaan regional yang lebih kecil.
        b. Memilih strategi penyerangan
        Secara umum ada lima strategi penyerangan yang dapat dipilih dan dilakukan market challanger.
        1) Serangan frontal, serangan ini dilakukan dengan mengerahkan seluruh kekuatan yang dimiliki tepat berhadapan dengan lawan. Serangan ini lebih bersifat menyerang kekuatan lawan ketimbang titik lemahnya. Dalam serangan frontal ini, penyerang menandingi produk, iklan, barga, dari lawannya, sehingga apabila lawan tidak kuat maka akan kalah. Biasanya yang memakai strategi ini adalah market challanger yang kuat.
        2) Serangan melambung, prinsip pokok dari serangan modern adalah konsentrasi kekuatan untuk menyerang kelemahan. Market challanger berpura-pura akan menyerang bagian yang kuat sehingga lawan mengerahkan seluruh kekuatan ke bagian tersebut, tetapi serangan yang sesungguhnya akan diarahkan kebagian kelemahannya. Ada dua strategi yang dapat dilakukan oleh market challanger yaitu serangan geografis, yaitu serangan-serangan yang ditujukan pada daerah-daerah pemasaran dimana pesaing tidak menanganinya dengan baik. dan kedua adalah serangan dengan menutup segmen pasar yang selama ini belum dipenuhi oleh market leader.
        3) Serangan mengepung, serangan ini merupakan usaha menembus daerah pemasaran lawan, yaitu dengan mengadakan penyerangan secara besar-besaran terhadap seluruh pasar lawan dan pada saat bersamaan perusahaan penantang memasarkan segala apa saja yang dipasarkan oleh pesaing, dan melebihi apa yang dimiliki oleh pesaing, sehingga tawaran perusahaan ini tidak mungkin ditolak oleh konsumen.

        4) Serangan lintas, strategi ini adalah strategi yang paling tidak langsung, serta menjauhkan diri dari gerakan yang mengarah kepemasaran pesaing. Ada tiga pendekatan, yaitu diversifikasi ke produk-produk yang tidak berkaitan, diversifikasi kepasar geografis yang baru dan menciptakan produk yang lebih baik.
        5) Serangan gerilya. Serangan ini dilakukan perusahaan-perusahaan yang kekurangan modal dengan menyerang pada berbagai wilayah lawan dengan serangan kecil yang tiba-tiba dan terputus-putus, tujuannya adalah untuk mengganggu konsentrasi lawan. Serangan dapat dilakukan dengan tindakan memotong harga secara selektif, mengganggu persediaan, membajak eksekutif, kegiatan promosi intensif dan berbagai tindakan ilegal lainnya. Selain ke lima strategi penyerangan secara umum tersebut, terdapat strategi yang lebih spesifik lagi bagi market challanger yaitu strategi pemotongan harga, strategi produk yang lebih murah, strategi produk prestise, strategi pengembang biakan produk, strategi inovasi produk, strategi penyempurnaan jasa pelayanan, strategi inovasi distribusi, strategi penekanan biaya, strategi promosi yang intensif
        3. Strategi pengikut pasar (Market follower)
        Perusahaan mengambil sikap tidak mengusik pemimpin pasar dan hanya puas dengan menyesuaikan diri dengan kondisi pasar, Selain menonjolkan ciri khas pada pasar sasaran seperti lokasi, Pelayan memilih untuk meniru produk dari pemimpin pasar dan penantang pasar dari pada menyerang mereka, Dan besarnya persentase pangsa pasar ≥ 10 % . Perusahaan seperti ini lebih suka menawarkan hal-hal yang serupa, biasanya dengan meniru produk perusahaan yang memimpin. Setiap market follower selalu menonjolkan sifat khasnya kepada target pasar, misalnya lokasi, jasa pelayanan, atau keuangannya. Strategi umum yang biasa dilakukan oleh maeket follower yaitu:
        a. Mengikuti dari dekat, market follower berusaha menyamai perusahaan pemimpin pasar pada sebanyak mungkin segmen pasar dan wilayah bauran pemasaran.
        b. Mengikuti dari jauh, dalam strategi ini market follower membuat beberapa differensiasi, namun tetap mengikuti market leader dalam hal pembauran pasar.
        c. Mengikuti secara selektif, market follower mengikuti dengan dekat beberapa hal yang dilakukan market leader, namum pada hal-hal yang lain perusahaan berjalan dengan sendiri.
        4. Strategi pengisi pasar (Market neichere)
        Perusahaan yang menghindar bentrok dengan perusahaan besar, Karakter berspesialisasi secara geografis, merupakan perusahaan yang daya beli dan ukurannya cukup besar agar bisa menguntungkan dan memiliki potensi untuk berkembang dengan persentase pangsa pasar ≤ 10 %. Perusahaan seperti ini, menyandang berbagai nama seperti penggarap relung pasar, spesialisasi pasar, perusahaan ambang pintu, atau perusahaan tumpuan. Market neichere menempati sebagian kecil dari seluruh pasar yang ada. Perusahaan jenis ini mencoba masuk kesatu atau lebih celah-celah pasar yang aman dan menguntungkan yang dilupakan atau terlewatkan oleh perusahaan besar. Umumnya market neichere adalah perusahaan yang mempunyai spesialisasi tertentu dan keahlian yang khas didalam pasar, konsumen, produk atau lini-lini dalam bauran pemasaran.
        Beberapa keadaan yang memaksa perusahaan untuk memperbaharui strategi
        Pemasaran, antara lain:
        1. Penjualan yang menurun
        2. Pertumbuhan yang semakin lambat, dimana perusahaan akan berusaha untuk memperoleh pasar sasaran yang baru.
        3. Berubahnya pola pembelian yang disebabkan oleh karena perubahan keinginan pelanggan yang cepat.
        4. Meningkatnya persaingan yang disebabkan oleh karena perubahan baru yang mempunyai kemampuan pemasaran yang tinggi
        5. Peningkatan pengeluaran pemasaran untuk periklanan promosi, penelitian pemasaran dan pelayanan pelanggan menjadi lebih tinggi sekali. Pihak Manajemen perusahaan ingin memperbaikinya.

        2.2.2 Faktor-Faktor Yang Mempengaruhi Strategi Pemasaran
        Adapun faktor faktor yang mempengaruhi strategi pemasaran yaitu:
        1. Lingkungan mikro perusahaan
        Lingkungan mikro perusahaan terdiri dari para pelaku dalam lingkungan yang langsung berkaitan dengan perusahaan yang mempengaruhi kemampuannya untuk melayani pasar yaitu:
        a. Perusahaan
        Yaitu struktur organisasi perusahaan itu sendiri. Strategi pemasaran yang diterapkan oleh bagian manajemen pemasaran harus memperhitungkan kelompok lain di perusahaan dalam merumuskan rencana pemasarannya, seperti manajemen puncak, keuangan perusahaan, penelitian dan pengembangan, pembelian, produksi, dan akuntansi serta sumber daya manusia yang dimiliki perusahaan, karena manajer pemasaran juga harus bekerja sama dengan para staff di bidang lainnya.
        b. Pemasok (Supplier)
        Para pemasok adalah perusahaan-perusahaan dan individu yang menyediakan sumber daya yang dibutuhkan oleh perusahaan dan para pesaing untuk memproduksi barang dan jasa tertentu. Kadang kala perusahaan juga harus memperoleh tenaga kerja, peralatan, bahan bakar, listrik dan faktor-faktor lain dari pemasok. Perkembangan dalam lingkungan pemasok dapat memberi pengaruh yang amat berarti terhadap pelaksanaan pemasaran suatu perusahaan. Manajer pemasaran perlu mengamati kecenderungan harga dari masukan-masukan terpenting bagi kegiatan produksi perusahaan mereka. Kekurangan sumber-sumber bahan mentah, pemogokan tenaga kerja, dan berbagai kejadian lainnya yang berhubungan dengan pemasok dapat mengganggu strategi pemasaran yang dilakukan dan dijalankan perusahaan.

        c. Para Perantara Pemasaran
        Para perantara pemasaran adalah perusahaan-perusahaan yang membantu perusahaan dalam promosi, penjualan dan distribusi barang/jasa kepada para konsumen akhir. Para perantara pemasaran ini meliputi
        Perantara perusahaan atau individu yang membantu perusahaan untuk menemukan konsumen. Mereka terbagi dua macam, yaitu agen perantara seperti agen, pialang dan perwakilan produsen yang mencari dan menemukan para pelanggan dan mengadakan perjanjian dengan pihak lain, tetapi tidak memiliki barang atau jasa itu sendiri. Perusahaan Distribusi Fisik, perusahaan seperti ini membantu perusahaan dalam penyimpanan dan pemindahan produk dari tempat asalnya ketempat-tempat yang dituju. Para Agen Jasa Pemasaran, seperti perusahaan atau lembaga penelitian pemasaran, agen periklanan, perusahaan media, dan perusahaan konsultan pemasaran, kesemuanya membantu perusahaan dalam rangka mengarahkan dan mempromosikan produknya ke pasar yang tepat. Perantara keuangan, seperti bank, perusahaan kredit, perusahaan asuransi, dan perusahaan lain yang membantu dalam segi keuangan.
        d. Para Pelanggan
        Yaitu pasar sasaran suatu perusahaan yang menjadi konsumen atas barang atau jasa yang ditawarkan perusahaan apakah individu-individu, Iembaga-lembaga, organisasi-organisasi, dan sebagainya.

        e. Para Pesaing
        Dalam usahanya melayani kelompok pasar pelanggan, perusahaan tidaklah sendiri. Usaha suatu perusahaan untuk membangun sebuah sistem pemasaran yang efisien guna melayani pasar gelati disaingi oleh perusahaan lain. Sistem pemasaran dan strategi yang diterapkan perusahaan dikelilingi dan dipengaruhi oleh sekelompok pesaing. Para pesaing ini perlu diidentifikasi dan dimonitor segala gerakan dan tindakannya didalam pasar.
        f. Masyarakat Umum
        Sebuah perusahaan juga harus memperhatikan sejumlah besar lapisan masyarakat yang tentu saja besar atau kecil menaruh perhatian terhadap kegiatan-kegiatan perusahaan, apakah mereka menerima atau menolak metode-metode dari perusahaan dalam menjalankan usahanya, karena kegiatan perusahaan pasti mempengaruhi minat kelompok lain, kelompok-kelompok inilah yang menjadi masyarakat umum. Masyarakat umum dapat memperlancar atau sebaliknya dapat sebagai penghambat kemampuan perusahaan untuk mencapai sasarannya.
        2. Lingkungan Makro Perusahaan
        Lingkungan makro terdiri dari kekuatan-kekuatan yang bersifat kemasyarakatan yang lebih besar dan mempengaruhi semua pelaku dalam lingkungan mikro dalam perusahaan yaitu:

        a. Lingkungan Demografis/Kependudukan
        Lingkungan demografis/kependudukan menunjukkan keadaan dan permasalahan mengenai penduduk, seperti distribusi penduduk secara geografis, tingkat kepadatannya, kecenderungan perpindahan dari satu tempat ke tempat lain, distribusi usia, kelahiran, perkawinan, ras, suku bangsa dan struktur keagamaan. Ternyata hal diatas dapat mempengaruhi strategi pemasaran suatu perusahaan dalam memasarkan produknya karena publiklah yang membentuk suatu pasar
        b. Lingkungan Ekonomi.
        Lingkungan ekonomi menunjukkan sistem ekonomi yang diterapkan, kebijakan-kebijakan pemerintah yang berkenaan dengan ekonomi, penurunan dalam pertumbuhan pendapatan nyata, tekanan inflasi yang berkelanjutan, perubahan pada pola belanja konsumen, dan sebagainya yang berkenaan dengan perkonomian.
        c. Lingkungan Fisik
        Lingkungan fisik menunjukkan kelangkaan bahan mentah tertentu yang dibutuhkan oleh perusahaan, peningkatan biaya energi, peningkatan angka pencemaran, dan peningkatan angka campur tangan pemerintah dalam pengelolaan dan penggunaan sumber-sumber daya alam.
        d. Lingkungan Teknologi
        Lingkungan teknologi rnenunjukkan peningkatan kecepatan pertumbuhan teknologi, kesempatan pembaharuan yang tak terbatas, biaya penelitian dan pengembangan, yang tinggi, perhatian yang lebih besar tertuju kepada penyempurnaan bagian kecil produk dari pada penemuan yang besar, dan semakin banyaknya peraturan yang berkenaan dengan perubahan teknologi.
        e. Lingkungan sosial/budaya
        Lingkungan ini menunjukkan keadaan suatu kelompok masyarakat mengenai aturan kehidupan, norma-norma dan nilai-nilai yang berlaku dalam masyarakat, pandangan masyarakat dan lain sebagainya yang merumuskan hubungan antar sesama dengan masyarakat lainnya serta lingkungan sekitarnya.

        2.3 Marketing Mix (Bauran Pemasaran )
        Marketing mix atau bauran pemasaran adalah perangkat alat pemasaran taktis yang dapat dikendalikan yang dipadukan oleh perusahaan untuk menghasilkan respon yang diinginkan pasar sasaran.

        Gambar 2.4 Empat Komponen Dalam Bauran Pemasaran
        Kotler dan Amstrong (1997) menghipotesiskan marketing mix (bauran pemasaran ) adalah perangkat alat pemasaran taktis yang dapat dikendalikan, yang dipadukan oleh perusahaan untuk menghasilkan respon yang diinginkan dalam pasar sasaran. marketing mix (baurana pemasaran ) terdiri dan segala sesuatu yang dapat dilakukan perusahaan untuk mempengaruhi permintaan produknya. Kemungkinan variabel yang dapat digolongkan menjadi empat kelompok yang dikenal sebagai 4P yang terdiri atas produk, harga, distribusi dan promosi.

        2.4.1 Produk
        Kotler dan Amstrong (1997) menghipotesiskan produk sebagai segala sesuatu yang dapat ditawarkan ke pasar untuk mendapatkan perhatian, dibeli, dipergunakan atau dikonsumsi dan yang dapat memuaskan keinginan atau kebutuhan. Produk meliputi objek secara fisik, pelayanan, orang, tempat, organisasi, gagasan, atau bauran dan semua wujud diatas.
        Swastha dan Sukotjo (1999) menghipotesiskan bahwa untuk pengembangan strategi pemasaran suatu produk, pemasaran melakukan beberapa kualifikasi produk berdasarkan tujuan yaitu:
        1. Barang konsumsi, adalah barang-barang yang dibeli untuk dikonsumsikan, pembelinya konsumen akhir dan barang-harang tersebut tidak diproses lagi, melainkan dipakai sendiri. Berdasarkan kebiasaan membeli dan konsumen, barang konsumsi dapat digolongkan menjadi 3 golongan yaitu:
        a. Barang konvenien adalah barang yang mudah dipakai, membelinya dapat di sembarang tempat dan pada setiap waktu
        b. Barang shoping adalah barang yang harus dibeli dengan mencari dahulu dan dalam membelinya harus dipertimbangkan masak-masak dengan membandingkan mutu, harga, kemasan dan sebagainya
        c. Barang spesial adalah barang yang mempunyai ciri khas dan hanya dapat dibeli ditempat tertentu saja. Dalam hal ini, pembeli yang ingin memperolehnya harus melakukan usaha-usaha khusus untuk membeli di tempat tertentu
        2. Barang industri adalah barang-barang yang dibeli untuk diproses lagi atau untuk kepentingan dalam industri, baik secara langsung atau tidak langsung dipakai untuk proses produksi. Kebijakan pemilihan produk harus sesuai dengan kebutuhan, kemampuan dan dapat menarik minat konsumen. Ketiga unsur ini harus ada agar transaksi dengan konsumen dapat terjadi. Produk juga harus sedemikian menarik sehingga dapat merangsang konsumen untuk membeli, untuk itu memang diperlukan informasi yang cukup meyakinkan tentang situasi pasar (Wibowo, 2000). Kotler dan Amstrong (2001) menambahkan bahwa suatu produk dapat ditawarkan dengan berbagai sifat sebagai alat untuk bersaing yang membedakan produk yang dihasilkan dengan produk pesaing. Spesifikasi produk merupakan sarana yang kompetitif untuk membedakan produk perusahaan dengan produk pesaing (Umar, 1999).

        2.4.2 Harga
        1. Pengertian harga
        Istilah harga adalah jumlah uang (kemungkinan ditambah beberapa barang) yang dibutuhkan untuk memperoleh beberapa kombinasi sebuah produk dan pelayanan yang menyertainya (Lamarto, 1996:308). Kotler dan Amstrong (2001:439) menghipotesiskan harga adalah sejumlah uang yang dibebankan atas suatu produk, atau jumlah dari nilai yang ditukar konsumen atas manfaat-manfaat karena memiliki atau menggunakan produk tersebut. Harga adalah nilai suatu barang yang dinyatakan dengan uang (Alma, 1992:79).

        2. Peranan harga
        Harga memiliki dua peranan utama dalam proses pengambilan keputusan para pembeli yaitu:
        a. Peranan alokasi dari harga, yaitu fungsi harga dalam membantu para pembeli untuk memutuskan cara memperoleh manfaat tertinggi yang diharapkan berdasarkan daya belinya. Dengan demikian dengan adanya harga dapat membantu para pembeli untuk memutuskan cara mengalokasikan daya belinya pada berbagai jenis barang atau jasa. Pembeli membandingkan harga dari berbagai alternatif yang tersedia, kemudian memutuskan alokasi dana yang dikehendaki.
        b. Peranan informasi dari harga, yaitu fungsi harga dalam mendidik konsumen mengenai faktor-faktor produk, seperti kualitas. Hal ini terutama bermanfaat dalam situasi dimana pembeli mengalami kesulitan untuk menilai faktor produksi atau manfaatnya secara objektif.
        3. Strategi penetapan harga
        Penetapan harga harus diarahkan demi tercapainya tujuan. Sasaran penetapan harga dibagi menjadi tiga (Stanton,1984:31)
        a. Berorientasi pada laba
        1) Mencapai target laba investasi atau laba penjualan perusahaan.
        2) Memaksimalkan laba
        b. Berorientasi pada penjualan
        1) Meningkatkan penjualan
        2) Mempertahankan atau meningkatkan pangsa pasar
        4. Strategi penyesuaian harga
        Perusahaan biasanya menyesuaikan harga dasar mereka untuk memperhitungkan perbedaan pelanggan dan perubahan situasi. Dibawah ini merupakan strategi penyesuaian harga diantaranya adalah:
        a. Penetapan harga diskon dan pengurangan harga.
        Mengurangi harga untuk memberikan penghargaan kepada pelanggan yang memberikan tanggapan seperti membayar lebih awal atau mempromosikan produk. Macam-macam diskon yang ditawarkan perusahaan:
        1) Diskon kas adalah pengurangan harga pada pembeli yang membayar tagihan mereka tepat waktu.
        2) Diskon kuantitas adalah pengurangan harga bagi pembeli yang membeli dalam volume besar.
        3) Diskon fungsional adalah pengurangan harga yang ditawarkan penjual bagi anggota jalur distribusi yang melakukan fungsi-fungsi tertentu.
        4) Diskon musiman adalah pengurangan harga bagi pembeli yang membeli barang atau jasa diluar musim.
        b. Penetapan harga tersegmentasi.
        Menyesuaikan harga untuk membuat perbedaan diantara pelanggan, produk maupun lokasi.
        1) Penetapan harga psikologis.
        Menyesuaikan harga untuk mempengaruhi secara psikologis.
        2) Penetapan harga promosi.
        Sewaktu-waktu mengurangi harga untuk meningkatkan penjualan dalam jangka pendek.
        3) Penetapan harga geografis.
        Menyesuaikan harga untuk memperhitungkan lokasi geografis pelanggan.
        4) Penetapan harga internasional.
        Menyesuaikan harga untuk pasar (Kotler & Amstrong, 2001:485). Dari pendapat-pendapat diatas dapat disimpulkan bahwa harga adalah jumlah uang yang digunakan untuk mendapatkan suatu barang. Dengan indikator ,tingkat harga, harga saingan, dan permintaan.

        2.4.3 Distribusi
        Kotler dan Armstong (1997) menghipotesiskan Saluran distribusi adalah perangkat organisasi yang saling tergantung dalam menyediakan satu produk atau jasa untuk digunakan atau dikonsumsi oleh konsumen atau pengguna bisnis. Distribusi menurut Musselman dan Jackson (1992) adalah rule yang harus dilalui oleh produk ketika produk itu bergerak dan produsen yang pertama ke pengguna atau pemakai terakhir, melalui sejumlah lembaga yang terlihat dalam meneruskan hak pemilikan barang.
        Dalam saluran distribusi terdapat strategi distribusi langsung (Direct chanel) dan distribusi tak langsung (Indirect Chanel), tujuan distribusi ini yaitu untuk mencapai jumlah pelanggan yang optimal pada waktu yang tepat dan biaya yang rendah namun dapat meraih dan menjaga tingkat pengendalian distribusi tertentu (Tjiptono,1997). Kebijaksanaan distribusi pada dasarnya adalah mengatur barang agar tersebar sesuai dengan kebutuhan konsumen. Kesulitan yang paling besar dalam kaitanya dengan kebijaksanaan distribusi adalah transportasi dan segala prasarana serta pengaturan waktu (Soekartawi, 2000).
        Swasta dan Irawan (1983) menghipotesiskan lembaga yang ikut ambil bagian dalam saluran distribusi tataniaga adalah, Produsen, Pedagang perantara, Konsumen akhir. Musselman dan Jackson (1992) menghipotesiskan saluran distribusi yang paling umum adalah produsen langsung kepada konsumen, produsen ke pengecer lalu ke konsumen, dan produsen kepada grosir kemudian kepada pengecer lalu konsumen
        Swastha dan Sukatjo (1999) menghipotesiskan macam-macam perantara yang ada adalah:
        1. Pedagang besar yang menjual barang kepada pengecer, pedagang besar lain atau pemakai industri
        2. Pengecer yang menjual barang kepada konsumen atau pembeli akhir
        3. Agen yang mempunyai fungsi hampir sama dengan pedagang besar meskipun tidak berhak memiliki barang yang dipasarkan
        Pedagang besar/grosir adalah sebuah unit usaha yang membeli dan menjual kembali barang-barang kepada pedagang pengecer dan tidak melayani penjualan eceran kepada konsumen akhir, sedangkan pedagang pengecer adalah sebuah lembaga yang melakukan kegiatan usaha menjual barang kepada konsumen akhir untuk keperluan pribadi atau non bisnis (Swasta dan Irawan, 1990).

        2.4.4 Promosi
        Musselman dan Jackson (1992) menghipotesiskan promosi adalah usaha dari perusahaan untuk mempengaruhi orang-orang agar mau membeli. Promosi pada dasarnya adalah suatu komunikasi, meliputi unsur-unsur pemberian informasi dan mempengaruhi perilaku pelanggan. Tujuannya adalah untuk mempertinggi citra perusahaan atau meningkatkan penjualan produk perusahaan. Untuk mengkomunikasikan produk ini perlu disusun suatu strategi yang sering disebut dengan strategi bauran promosi (promotion mix) yang terdiri atas 4 komponen utama yaitu :
        1. Periklanan (advertising) adalah segala bentuk penyajian dan promosi non pribadi yang dibayar, baik mengenai gagasan, barang atau jasa oleh sponsor yang teridentifikasi.
        2. Promosi penjualan (sales promotion) adalah insentif jangka pendek untuk meningkatkan pembelian atau penjualan suatu produk dan jasa.
        3. Hubungan masyarakat (public relations) adalah membangun hubungan yang baik dengan menghasilkan publik perusahaan dengan menghasilkan publisitas yang menyenangkan, menumbuh kembangkan suatu citra perusahaan yang baik, menangani atau melenyapkan cerita dan peristiwa yang tidak menyenangkan.
        4. Penjualan perorangan (personal seling) adalah komunikasi langsung antara penjual dan calon pelanggan untuk memperkenalkan suatu produk kepada calon pelanggan dan membentuk pemahaman pelanggan terhadap produk sehingga mereka akan mencoba dan membelinya.
        Bauran promosi terdiri dan empat komponen tersebut. Merupakan suatu perangkat yang akan menentukan keberhasilan pemasaran berupa kepuasan konsumen (Swastha, 1993).
        Musselman dan Jackson (1992) menghopotesiskan dalam memuaskan kebutuhan konsumen, maka kombinasi komponen-komponen bauran promosi harus dapat diimplementasikan oleh perusahaan dengan baik melalui struktur organisasinya. Keberhasilan iklan tergantung kepada pesan dan media yang dipilih. Beberapa perusahaan hampir menggunakan semua media periklanan seperti surat kabar, majalah, radio, televisi, iklan angkutan, pameran barang yang dijual dan sarana-sarana khusus.

        Komentar oleh Firdaus | Januari 17, 2012

      • A. Obyek/Populasi Penelitian
        Dalam penulisan skripsi ini yang menjadi obyek penelitian adalah Distro The Zombie Jambi di Jambi. Sedangkan subyek/populasi dari penelitian ini adalah pembeli produk pakaian merek starcross di Distro The Zombie di Jambi.

        B. Jenis Data
        Data yang digunakan dalam penelitian ini adalah data primer, yang diperoleh langsung dari responden.

        C. Metoda Pengumpulan Data
        Untuk memperoleh data yang relevan terhadap penelitian ini, maka penulis menggunakan kuesioner sebagai alat pengumpulan data. Kuesioner diberikan secara langsung pada responden.

        D. Pengambilan Sampel
        Sampel adalah sebagian dari populasi yang peneliti teliti. Teknik pengambilan sampel dalam penelitian ini adalah sampling kemudahan (metode convenience sampling) yaitu pengambilan sampel dari elemen populasi yang datanya mudah diperoleh oleh peneliti (Soehardi, S 1999). Sehingga peneliti memiliki kebebasan untuk memilih sampel yang paling cepat dan murah. Jumlah sampel yang diambil adalah 70 responden karena berdasarkan tingkat keyakinan peneliti bahwa 70 responden sudah cukup mewakili dari populasi.

        Komentar oleh Firdaus | Januari 25, 2012

      • PERBAIKAN
        BAB II

        A. Obyek/Populasi Penelitian
        Dalam penulisan skripsi ini yang menjadi obyek penelitian adalah Distro The Zombie Jambi di Jambi. Sedangkan subyek/populasi dari penelitian ini adalah pembeli produk pakaian merek starcross di Distro The Zombie di Jambi.

        B. Jenis Data
        Data yang digunakan dalam penelitian ini adalah data primer, yang diperoleh langsung dari responden.

        C. Metoda Pengumpulan Data
        Untuk memperoleh data yang relevan terhadap penelitian ini, maka penulis menggunakan kuesioner sebagai alat pengumpulan data. Kuesioner diberikan secara langsung pada responden.

        D. Pengambilan Sampel
        Sampel adalah sebagian dari populasi yang peneliti teliti. Teknik pengambilan sampel dalam penelitian ini adalah sampling kemudahan (metode convenience sampling) yaitu pengambilan sampel dari elemen populasi yang datanya mudah diperoleh oleh peneliti (Soehardi, S 1999). Sehingga peneliti memiliki kebebasan untuk memilih sampel yang paling cepat dan murah. Jumlah sampel yang diambil adalah 70 responden karena berdasarkan tingkat keyakinan peneliti bahwa 70 responden sudah cukup mewakili dari populasi.

        Komentar oleh Firdaus | Januari 25, 2012

  56. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL :
    1) “Analisis Pengaruh Promosi Terhadap Keputusan Pembelian Konsumen Pada Abadi Swalayan”
    2) “Pelaksanaan Promosi Dalam Upaya Memelihara Loyalitas Pelanggan Pada PT. INDOSAT Cabang JAMBI”.

    Rahmat kenapa kamu sampaikan sampai tiga judul, cukup satu tapi potensil untuk dijadikan objek penelitian.

    Komentar oleh rahmat | Desember 24, 2011 | Balas

  57. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL :
    3) “Analisis Pengaru

    h Biaya Promosi Terhadap Volume Tingkat Hunian Kamar Pada Hotel Abadi Jambi”
    Rahmat judul seperti ini sudah banyak, biaya promosi dan tingkat hunian kamar. Coba temukan sesuatu yang membuar berbeda peneltiannmu ini? Objeknya tetap Abadi, tapi lihat sesuatu yag berbeda dg strategi yg mereka lakukan. Kerja keras lagi.

    Komentar oleh rahmat | Desember 24, 2011 | Balas

    • Mohon bantuannya pak diantara 3 judul yang saya ajukan ini, yang mana lebih berpotensi untuk saya lanjutkan,,, Terimakasih……

      Komentar oleh rahmat | Desember 24, 2011 | Balas

    • Rhmatulah judulmu yg mana, proposal tentatif ditunggu.

      Komentar oleh johannessimatupang | Januari 11, 2012 | Balas

  58. TUGAS : 1 (INDIVIDU)
    NAMA : YUDI ANDRIANSYAH PUTRA
    NIM : C1B009039
    KELAS : MGT A 09

    JUDUL : ANALISIS PENGARUH FAKTOR KUALITAS PELAYANAN TERHADAP KEPUASAN PELANGGAN PADA GRAND HOTEL JAMBI.

    Yudi, Grand hotel masih termasuk baru, belum genap 3 tahun. Maksud saya kalau dilihat kualitas masih kurang tepat. Tapi coba temukan sesuatu yg menarik misalnya bagaimana mereka membuat promosi penjualan sehingga konsumen menarik. Atau jangan dilihat penjualan kamar, tapi penggunaan ruang pertemuannya. Silahkan diperbaiki lagi.

    Komentar oleh yudi andriansyah putra | Desember 24, 2011 | Balas

    • TUGAS : 1 (INDIVIDU)
      NAMA : YUDI ANDRIANSYAH PUTRA
      NIM : C1B009039
      KELAS : MGT A 09

      PERBAIKAN JUDUL SEBELUMNYA

      ” PENERAPAN STRATEGI MARKETING GUNA MENINGKATKAN VOLUME PENJUALAN PADA PRODUK MAKANAN MARTABAK ULAMA INDIA (MUI)”

      Yudhi, coba perbaiki lagi judulmu. Banyak baca, baru temukan ide. Saya sarankan segera perbaiki, karena minggu depan semua akan dievaluasi.

      Komentar oleh yudi andriansyah | Januari 5, 2012 | Balas

  59. TUGAS 1 (INDIVIDU)
    NAMA : AGUS RIYANTO
    NIM : C1B009147
    KELAS MGT G’09

    JUDUL : “ANALISIS FAKTOR – FAKTOR PRILAKU KONSUMEN TERHADAP KEPUTUSAN PASIEN BEROBAT DI PUSKESMAS PAL MERAH II GUNA MENINGKATKAN KUALITAS PELAYANANNYA”

    Agus jdul seperti ini sudah banyak diusulakan oleh kakak-kakak kelasmu.

    Komentar oleh Agus Diningrat Wijaya | Desember 24, 2011 | Balas

    • jadi di ganti dengan judul yang lain ya pak jo ?

      Ajukan judul sederhana, mudah dipahami orang lain dan dapat dikerjakan oleh peneliti.

      Komentar oleh Agus Diningrat Wijaya | Desember 31, 2011 | Balas

      • maaf pak jo saya baru memikirkan gantinya dari judul saya .
        ini judul saya pak jo yang saya perbaikai .

        Analisis strategi market leader terhadap marketing competency pada koran Tribun Jambi

        tolong di komentari pak jo .
        trima kasih pak .

        Topik mu ok, tapi judul dan konteksnya berbeda. Judul coba ditukar: Analisis persepsi harga koran Tribun dan posisi pasar.

        Komentar oleh Agus Diningrat Wijaya | Januari 7, 2012

      • Judul : Analisis Persepsi Konsumen Terhadap Pengaruh Harga Koran TRIBUN JAMBI dan Posisi Pasarnya
        BAB I
        PENDAHULUAN
        1. LATAR BELAKANG
        Dewasa ini kemajuan teknologi sangat pesat, sehingga berbagai jenis barang yang dibutuhkan konsumen dapat dengan mudah didapatkan. Dengan adanya berbagai ragam produk tersebut menyebabkan konsumen harus berfikir kritis dalam menentukan pilihan produknya, sehingga produsen berusaha bersaing untuk merebut minat konsumen dan pangsa pasar dengan cara yang lebih agresif dalam melakukan strategi pemasaran.
        Secara umum semua perusahaan bertujuan untuk mendapatkan keuntungan yang optimal, maka kegagalan dalam melaksanakan kegiatan pemasaran akan membawa akibat – akibat yang cukup fatal bagi perusahaan.
        Usaha – usaha pemasaran untuk menguasai dan memperluas pasar mempunyai arti yang sangat penting, untuk itu perlu ditempuh berbagai cara demi mencapai tujuan tersebut. Seperti yang diketahui, bahwa konsep dan strategi pemasaran akan selalu berkembang sesuai dengan perkembangan zaman, sebab dalam pembauran pemasaran ( marketing mix ) telah mencakup strategi pemasaran. Maka dari itulah setiap perusahaan harus mampu mengikuti perkembangan teknologi agar dapat memperluas daerah pasar.
        Pemasaran sebagai suatu sistem dari kegiatan – kegiatan yang saling berhubungan, meliputi kegiatan merencanakan dan menentukan produk , harga saluran distribusi dan promosi berupa barang dan jasa kepada kelompok pembeli. Kegiatan – kegiatan pemasaran tersebut beroperasi dalam suatu lingkungan yang dibatasi oleh sumber – sumber dari perusahaan itu sendiri, peraturan – peraturan, maupun kensekuensi yang ditimbulkan, sebagai akibat adanya dinamika pasar. Keunggulan suatu pasar juga ditentukan oleh komitmen para karyawan perusahaan untuk menciptakan dan memuaskan pelanggan.
        Disamping itu perusahaan ingin unggul harus mengetahui bagaimana menyesuaikan diri dan menanggapi perubahan pasar yang terus – menerus terjadi. Oleh sebab itu harus membuat perencanaan bauran pemasaran yang berorientasi pada pasar. Ada unsur ( marketing mix ) dasar yang dapat mempengaruhi perkembangan perusahaan, yaitu : product, place, price dan promotion.
        Pelaksanaan atau penerapan dari bauran pemasaran diharapkan dapat menarik minat konsumen terhadap produk yang dihasilkan sehingga mereka merasa terdorong untuk melakukan pembelian. Strategi pemasaran merupakan alat utama bagi perusahaan untuk dapat menguasai pasar yang diharapkan. Oleh karena itu, sangat penting bagi perusahaan untuk merumuskan strategi pemasaran yang tepat dalam rangka mencapai omset penjualan yang ditargetkan.
        Berdasarkan uraian di atas, penulis merasa tertarik untuk mengangkat strategi pemasaran sebagai kajian penelitian, sebab perusahaan yang sedang menghadapi kekuatan yang sangat melunjak tinggi mengenai pelaksanaan pemasaran yang efektif dalam memasarkan produknya.
        Atas dasar pertimbangan diatas maka penulis tertarik untuk membuat penulisan ilmiah yang berjudul “ Analisis Persepsi Konsumen Terhadap Pengaruh Harga Koran TRIBUN JAMBI dan Posisi Pasarnya “

        2. RUMUSAN MASALAH
        Pada umumnya suatu perusahaan dalam menjalankan kepentingan selalu berkeinginan untuk mendapat dan meraih keuntungan yang sesuai dangan target yang telah ditentukan bahkan melebihi target yang telah ditentukan hingga perusahaan menjadi market leader dalam berkompetensi dengan perusahaan lain. Untuk mencapai target tersebut, maka proses kegiatan perusahaan diharapkan tidak mengalami hambatan – hambatan.
        Strategi pemasaran merupakan salah satu alat yang penting untuk mguasai pasar, penetrasi pasar dapat dilaksanakan deengan bauran pemasaran yang lebih baik. Dari uraian diatas maka penulis memberikan rumusan masalah sebagai berikut :
        a. Bagaimana pengaruh harga koran TRIBUN JAMBI terhadap informasi yang diberikan kepada konsumen ?
        b. Bagaimana pengaruh posisi pasar terhadap volume penjualan koran TRIBUN JAMBI ?

        3. TUJUAN PENELITIAN
        Dengan membuat penulisan ilmiah ini diharapkan kita dapat mengetahui pemikiran – pemikiran berharga dalam meningkatkan dan mengembangkan ilmu pemasaran pada perusahaan koran TRIBUN JAMBI dalam memperkenalkan dan menyalurkan produk unggulannya kepada konsumen. Oleh karena itu, tujuan penulisan skripsi ini adalah :
        a. Untuk menganalisis pengaruh harga koran TRIBUN JAMBI terhadap informasi yang diberikan kepada konsumen.
        b. Untuk menganalisis pengaruh posisi pasar terhadap volume penjualan koran TRIBUN JAMBI.

        4. MANFAAT PENELITIAN
        Dengan penulisan ilmiah ini diharapkan bermanfaat untuk perusahaan koran TRIBUN JAMBI maupun pihak luarnya ataupun konsumen yang loyal terhadap koran TRIBUN JAMBI. Olah karena itu penulis mengharapkan manfaat sebagai berikut :
        a. Bagi peneliti, dengan penelitian ini diharapkan kepada peneliti agar mampu menerapkan ilmu yang telah didapat di bangku kuliah dan dapat merealisasikannya di dalam kehidupan sehari – hari bahkan ke dunia usaha yang sebenarnya.
        b. Bagi perusahaan koran TRIBUN JAMBI, dengan adanya penelitian ini diharapkan dapat memberikan kontribusi yang positif , baik berkaitan dengan persepsi konsumen maupun loyalitas konsumen terhadap produk korannya.
        c. Bagi pihak Universitas, dapat memberikan informasi dan dapat menjadikan penelitian ini sebagai bahan studi lebih lanjut terhadap penelitian dengan topik yang sama.

        BAB II
        METODE PENELITIAN

        1. Obyek / Populasi Penelitian
        Dalam penulisan ilmiah ini, peneliti menetapkan obyek penelitian pada Perusahaan Koran TRIBUN JAMBI. Sedangkan subyek / populasi dari penelitian ini adalah konsumen pembaca koran TRIBUN JAMBI.
        2. Jenis Data
        Data yang digunakan dalam penelitian ini adalah data primer, yang peneliti dapatkan langsung dari responden.
        3. Metoda Pengumpulan Data
        Dalam penelitian ilmiah ini, peneliti menggunakan kuesioner sebagai alat pengumpulan data. Kuesioner ini diberikan kepada responden secara langsung agar mendapat data yang relevan untuk penelitian ini.
        4. Teknik Pengambilan Sampel
        Sampel adalah bagian dari jumlah dan karakteristik, misalnya karena keterbatasan dana, tenaga dan waktu, maka peneliti dapat menggunakan sampel yang diambil dari populasi itu. Apa yang dipelajari dari sampel itu, kesimpulannya akan dapat diberlakukan untuk populasi. Untuk itu sampel yang diambil dari populasi harus betul-betul representatif (mewakili). (Sugiyono, 2009:62)
        Dalam penelilitian ini digunakan metode convenience sampling (sampling kemudahan) yaitu pengambilan sampel dari elemen populasi yang datanya dapat dengan mudah diperoleh oleh peneliti. Sampel yang diambil berjumlah 150 responden, karena sudah dianggap mamu untuk mewakili populasinya.

        Agus topikmu ok, tapi judulmu harus diperbaiki. Mana variabel independen dan dependen tidak teridentifikasi dg Jelas.

        Komentar oleh Agus Riyanto | Januari 22, 2012

      • ini variabel penelitian saya pak .

        2.1. Variabel Penelitian
        Variabel dalam penelitian ini merupakan suatu variabel yang ditentukan dengan tujuan untuk memperoleh informasi agar bisa ditarik suatu kesimpulan dari variabel tersebut.
        Berdasarkan pemikiran dari penelitian ini, maka peneliti menyimpulkan bahwa ada 2 variabel yang digunakan dalam penelitian ilmiah ini, yaitu :

        2.1.1. Variabel Dependen ( X )
        Variabel ini merupakan variabel terikat yang besarannya tergantung dari besaran variabel independen (bebas). Besarnya perubahan yang disebabkan oleh variabel independen ini, akan memberi peluang terhadap perubahan variabel dependen (terikat) sebesar koefisien (besaran) perubahan dalam variabel independen. Variabel dependennya adalah harga ( X1 ) dan posisi pasar ( X2 )
        2.1.2. Variabel Independen ( Y )
        Variabel ini merupakan variabel yang menjadi sebab perubahan atau timbulnya variabel dependen ( terikat ). Variabel independennya adalah persepsi kosumen.

        Gus variabel yg dimaksud bukan definisinya, tapi operasionalisasinya. Tapi tugas kita tak sampai ke situ. PErhatikan penugasan kita lebih kepada alasan penelitian hingga kepada penentuan sampel dan pupulasi.

        Komentar oleh Agus Riyanto | Januari 25, 2012

  60. TUGAS 1 (INDIVIDU)
    NAMA : YANOV ARUM K.P
    NIM : C1B009078
    KELAS : MGT B’09

    JUDUL : MENGANALISA FAKTOR-FAKTOR YANG MEMPENGARUHI PRILAKU KONSUMEN DALAM MEMBELI HELM MERK KYT.

    Yanov, judul mirip ini sudah diajukan oleh Dalles. Cari judul lain.

    Komentar oleh YANOV | Desember 24, 2011 | Balas

  61. NAMA : DEDY SUDARMADI
    NIM : ERC1B009057
    kelas sore manajemen

    JUDUL ” Persepsi masyarakat tentang produk handpone buatan Cina”

    mohon saranya pak

    Komentar oleh DEDY SUDARMADI | Desember 26, 2011 | Balas

  62. TUGAS INDIVIDU
    NAMA : ANDI SAFUTRA
    NIM : C1B008136
    KELAS : MGT G08 PAGI

    ” ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI MINAT BELI KONSUMEN PADA IKLAN FLEXY”

    Andi judulmu ini berulang, coba pikirkan yg lain, objek boleh tetap Flexy tapicari atribut flexi yg tak ada pada jenis lain, misalnya pengguna Combo.

    Komentar oleh andi safutra | Desember 26, 2011 | Balas

  63. TUGAS INDIVIDU
    NAMA : M. RIVAN
    NIM : C1B008136
    KELAS : MGT G08 PAGI

    ANALISIS PENELITIAN PENGARUH HARGA, KUALITAS PRODUK, DAN KERAGAMAN PRODUK
    TERHADAP LOYALITAS KONSUMEN PADA SABUN MANDI
    LUX

    Rivan, topikmu potensil, tapi judul masih perlu diperbaiki.

    Komentar oleh muhammad rivan | Desember 26, 2011 | Balas

  64. TUGAS INDIVIDU
    NAMA : REZA FAHLEFY
    NIM : C1B008144
    KELAS : MGT G08 PAGI

    ” Analisis Indeks Kepuasan Masyarakat Terhadap Pelayanan yang Diberikan Oleh Petugas Kelurahan kota baru jambi (Studi Kasus Pembuatan KTP) ”

    Reza, saya setuju topik ini tapi jangan ditingkat RT, tapi tingkat Kecamatan. Judulnya juga diobah menjadi Analisis Kepuasan Pelanggan Terhadap Pelayanan KTP Elektronik. Dalami kasus ini.

    Komentar oleh reza fahlefy | Desember 26, 2011 | Balas

    • Terimah kasih pak, jadi untuk proses selanjut nya ini sudah bisa saya lanjutkan untuk di buat proposal tentatif pak ? Dengan perubahan judul sebagai mana dari saran bapak tadi ?

      Komentar oleh Reza Fahlevi | Januari 7, 2012 | Balas

  65. Tugas Individu
    Nama : Asset Winardi
    NIM : ERC1B009025
    Kelas Ekstensi Sore

    Judul : “ANALISIS FAKTOR PERILAKU KONSUMEN TERHADAP KEPUTUSAN PEMBELIAN PRODUK AIR MINUM DALAM KEMASAN MEREK ARTHES”. (STUDI PADA KONSUMEN DI KELURAHAN KENALI BESAR)

    Komentar oleh assetwinardi | Desember 26, 2011 | Balas

  66. NAMA : MUH DONG HAMDA
    NIM : C1B009105
    KELAS: MGT G 09

    judul : pengembangan strategi pelayanan pada PT. BANK MANDIRI terhadap nasabah maupun masyarakat jambi

    Nuh, judulmu masih terlaluluas. Kalau mau Bank Mandiri, temukan satu produk mereka. Bisa produk karena baru karena memang banyak perannya terhadap Mandiri. Coba lagi.

    Komentar oleh muh dong hamda | Desember 26, 2011 | Balas

    • ANALISIS PENGARUH PERSEPSI KONSUMEN TERHADAP TINGKAT PEMBELIAN PADA PRODUK KECAP CAP 2 AYAM DI JAMBI

      BAB I

      PENDAHULUAN

      A.Latar Belakang Masalah

      Seiring dengan kemajuan pesat dalam dunia teknologi di indonesia, bidang industri juga mengalami kemajuan yang cukup pesat. ini merupakan suatu hal yang penting yang dianggap mampu membantu roda perekonomian di indonesia .oleh karena itu pemasaran merupakan salah satu kegiatan yang harus di lakukan dalam menghadapi persaingan yang sangat kompetitif . Banyaknya perusahaan yang muncul baik perusahaan kecil maupun perusahaan besar sangat berdampak pada persaingan yang sangat ketat antar semua perusahaan . Sejak bermunculan produk produk baru, Semakin lama pola pikir konsumen berubah seiring dengan perkembangan dan keunikan produk baru , selain itu juga konsumen kini mulai beralih karena perusahaan yang memasarkan produk nya dengan strategi yang handal , mulai dari menetapkan harga , promosi , dan mendistribusikan barang secara efektif

      Pada dasarnya semua perusahaan perusahaan terkendala dalam memahami dan menganalisisi perilaku konsumen secara tepat . karena banyak faktor yang mempengaruhi perilaku konsumen dan juga ada perbedaan perilaku untuk masing masing individu , kelompok dan kelas sosial , dengan demikian perusahaan di tuntut untuk dapat mengtahui perubahan perubahan yang terjadi dalam perilaku konsumen , dan termasuk cara konsumen untuk mendapatkan atau memilih produk sesuai dengan seleranya masing masing.dengan demikian pemasar melakukan operasi pasar yang sesuai situasi yang terjadi pada saat ini ,

      Produk kecap cap 2 ayam adalah produk yang telah di rancang untuk kebtuhan konsumen terutama untuk kebutuhan rumah tangga konsumen khususnya di jambi, dan kecap cap 2 ayam ini adalah salah satu produk penyedap rasa yang semakin lama semakin banyak di butuhkan oleh ibu rumah tangga , karena kemudahan dalam hal penyajian , dengan semakin banyaknya penyedap rasa dipasaran berati memberikan keluasan bagi konsumen untuk memilih merk yang sesuai dengan keinginan, maka dari itu perlu bagi pemasar untuk menganalisis prilaku konsumen kecap cap 2 ayam untuk mengetahui pola pembelian . dengan banyaknya merk kecap yang ada di pasaran akan mendorong perusahaan untuk berssaing secara kompetitif untuk menanamkan minat pembeli melalui berbagai strategi yang tepat, misal nya mengubah bentuk kemasan , promosi , warna , dan harga .

      Dalam memenuhi kebutuhan sehari hari terdapat berbagai keanekaragaman konsumen yang dapat di pengaruhi oleh berbagai faktor , baik yang berasal dari dalam dri konsumen maupun dari luar diri konsumen , sering kita ketahui faktor yang timbul dari dalam diri seseorang berupa sikap , motivasi , persepsi dan lain lain . adapun dari faktor diluar diri seseorang adalah faktor sosial,pribadi, dan psikologis .
      Dari uraian tersebut maka judul yang tepat dalam penelitian ini adalah
      “ANALISIS PENGARUH KONSUMEN TERHADAP TINGKAT PEMBELIAN PADA PRODUK KECAP CAP 2 AYAM DI JAMBI “

      B. Perumusan masalah

      Berdasarkan latar belakang permasalahan diatas maka dapat ditarik perumusan masalah antara lain :

      1. Apa faktor yang mempengaruhi konsumen sehingga memilih mengkonsumsi kecap cap 2 ayam ?
      2. Bagaimana pengaruh konsumen terhadap tingkat pembelian pada produk kecap cap 2 ayam ?

      C. Tujuan penelitian

      Berdasarkan rumusan masalah tersebut maka disusun tujuan dari penelitian ini adalah mengetahui :

      1. Untuk menganalisis faktor yang mempengaruhi konsumen untuk memilih menkonsumsi kecap cap 2 ayam
      2. Untuk mengetahui seberapa besar pengaruh konsumen terhadap tingkat pembelian pada produk kecap cap 2 ayam

      D. Manfaat penelitian

      1. Bagi perusahaan bahwa penelitian dapat digunakan sebagai bahan informasi dan masukan bagi pihak pemasar dan perusahaan untuk lebih mengetahui faktor yang paling berpengaruh yang menjadi pertimbangan konsumen untuk menkonsumsi produk yang telah kita tawarkan sehingga pihak perusahaan senantiasa lebih bisa menyusun strategi dalam rangka memnuhi permintaan dan harapan konsumen
      2. Bagi penulis, selain untuk syarat menyelesaikan pendidikan, juga bisa menambah ilmu pengetahuan yang luas tentang bagaimana cara untuk mengetahui faktor yang sangat mempengaruhi prilaku konsumen, dan melatih penulis untuk dapat menerapkan teori teori yang diperoleh dibangku perkuliahan.
      3. Bagi universitas, hasil penelitian ini dapat digunakan sebagai bahan perbandingan dan referensi untuk penelitian berikutnya

      BAB II

      METODE PENELITIAN

      A. Obyek / populasi penelitian
      Dalam penulisan skripsi ini peneliti / penulis menjadikan perusahaan cap ayam jago sebagai objek penelitian. Sedangkan untuk subjek / populasi dari peneliti adalah knsumen pengguna kecap cap 2 ayam

      B. Variable penelitian
      Dalam penelitian ini variable terbagi atas variable yaitu variable dependent dan variable independent, variable dependen dari penelietian ini adalah perilaku konsumen ( X ) sedangkan untuk variable independennya adalah keputusan pembelian konsumen ( Y ).

      C. Jenis data
      Jenis data yang digunakan dalam peneitian adalah data primer, yang mana data primer ini data yang didapat langsung dari responden

      D. Metode pengumpulan data
      Dalam proses penelitian ini, peneliti / penulis menggunakan kuisioner sebagai alat pengumpulan data yang di berikan secara langsung kepada responden

      E. Tehnik pengambilan sample
      Sample adalah sebagian dari populasi yang telah diteliti. Teknik sampling yang digunakan dalam penelitian ini adlah dengan metode convenience sampling atau sampling kemudahan yaitu pengambilan sample dari elemen populasi yang datanya sangat mudah diperoleh dan didapat oleh peneliti
      Dari penjelasan diatas dapat diketahui bahwa peneliti dapat memilih sample dengan cepat dan tepat, yang mana jumlah samle yang diambil adalah 120 yang dianggap telah mampu mewakili populasi dari penelitian ini.

      Judul ini sepertinya baru saja saya baca. Sampai ketemu saat presentasi.

      Komentar oleh Muh. Dong Hamda | Januari 26, 2012 | Balas

  67. TUGAS I (INDIVIDU)
    NAMA : NANDA REGEN
    NIM : C1B008137
    MGT G’08

    judul :
    “Analisis Factor Factor Kesejahteraan pekerja Industri Rumah Tangga (Batu Bata) Di Setiti Muaro Jambi”

    Nanda, judul ini cenderung bukan bidang kajian Pemasaran, temukan judul lain. Kerja keras lagi.

    Komentar oleh Nanda regen | Desember 26, 2011 | Balas

    • Maaf pak kalau judul nya saya rubah menjadi :

      “Analisis Strategi pemasaran terhadap peningkatan penjualan gas elpiji 3 kilo pada PT carpotama putra perkasa jambi”

      Bagai mana menurut pak jo…..???
      tolong d beri komentar nya pak…..????

      Komentar oleh Nandaregen | Januari 6, 2012 | Balas

      • ANALISIS FAKTOR-FAKTOR YANG
        MEMPENGARUHI MINAT BELI ULANG
        GAS ELPIJI 3 KG
        (Di PT.BIN BAUD KARYA MAJU JAMBI
        )

        Komentar oleh NANDA REGEN | Januari 22, 2012

      • BAB I

        PENDAHULUAN

        Latar Belakang Masalah

        Syarat yang harus dipenuhi oleh suatu perusahaan agar dapat sukses dalam
        persaingan adalah berusaha mencapai tujuan untuk menciptakan dan
        mempertahankan pelanggan (Levitt, 1987). Dalam pemasaran rasional, penarikan
        pelanggan baru hanyalah salah satu langkah awal dari proses pemasaran (Berry,
        1983). Selain itu mempertahankan pelanggan jauh lebih murah bagi perusahaan
        daripada mencari pelanggan baru, yaitu diperlukan biaya lima kali lipat untuk
        mendapatkan seorang konsumen baru daripada mempertahankan seorang yang sudah
        menjadi pelanggan. Dengan demikian, setiap perusahaan harus mampu memahami
        perilaku konsumen pada pasar sasarannya, karena kelangsungan hidup perusahaan
        tersebut sebagai organisasi yang berusaha memenuhi kebutuhan dan keinginan para
        konsumen sangat tergantung pada perilaku konsumennya.
        Tujuan pemenuhan kebutuhan maupun keinginan adalah tercapainya tingkat
        kepuasan setinggi mungkin. Kemampuan produk untuk memberikan kepuasan
        tertinggi kepada pemakainya akan menguatkan kedudukan atau posisi produk tersebut
        dalam benak atau ingatan konsumen dan akan menjadi pilihan pertama bilamana
        terjadi pembelian pada waktu yang akan datang. Perusahaan yang bertujuan
        memberikan kepuasan tertinggi bagi konsumen akan berusaha menetapkan suatu
        strategi pemasaran yang sesuai dengan keinginan dan kebutuhan konsumen. Upaya
        17
        kearah itu dilakukan melalui studi atau penelitian dengan maksud mencari sejumlah
        informasi tentang faktor-faktor yang mempengaruhi perilaku konsumen dalam
        membeli suatu produk.
        Upaya meneliti perilaku konsumen perlu dilakukan karena pemahaman
        terhadap perilaku konsumen merupakan kunci keberhasilan strategi pemasaran.
        Melalui pemahaman perilaku konsumen, pihak manajemen perusahaan dapat
        menyusun strategi dan program yang tepat dalam rangka memanfaatkan peluang yang
        ada dan mengungguli para pesaingnya. Perilaku konsumen sendiri merupakan
        tindakan-tindakan individu yang secara langsung terlibat dalam usaha memperoleh,
        menggunakan, dan menentukan produk dan jasa termasuk proses pengambilan
        keputusan yang mendahului dan mengikuti tindakan-tindakan tersebut (Engel et al.,
        1990).
        Minat beli merupakan bagian dari komponen perilaku dalam sikap
        mengkonsumsi. Menurut Kinnear dan Taylor (1995; dalam Sukmawati dan Durianto,
        2003) minat membeli adalah merupakan bagian dari komponen perilaku konsumen
        dalam sikap mengkonsumsi, kecenderungan responden untuk bertindak sebelum
        keputusan membeli benar-benar dilaksanakan. Sedangkan minat beli ulang
        merupakan minat pembelian yang didasarkan atas pengalaman pembelian yang telah
        dilakukan dimasa lalu.
        Minat beli ulang yang tinggi mencerminkan tingkat kepuasan konsumen ketika
        memutuskan untuk mengadopsi suatu produk. Keputusan untuk mengadopsi produk
        timbul setelah konsumen mencoba produk tersebut dan kemudian timbul rasa suka
        18
        atau tidak suka terhadap produk. Rasa suka terhadap produk dapat diambil bila
        konsumen mempunyai persepsi bahwa produk yang mereka pilih berkualitas baik dan
        dapat memenuhi atau bahkan melebihi keinginan dan harapan konsumen. Dengan
        kata lain produk tersebut mempunyai nilai yang tinggi di mata konsumen. Tingginya
        minat membeli ini akan membawa dampak yang positif terhadap keberhasilan produk
        di pasar.
        Obyek lokasi penelitian ini pada PT. Bin Daud Karya maju, Eksistensi usaha
        gas sangat ditentukan oleh seberapa besar kegiatan pemasaran yang dilakukan.
        Perusahaan gas elpiji 3 Kg PT. Bin Daud Karya Maju dalam menarik konsumen
        adalah dengan menawarkan produk dengan harga yang pantas atau relevan, lokasi
        yang strategis, proses pelayanan yang cepat, sumber daya manusia yang ramah,
        terampil, dan memiliki kompetisi, ruangan dan lingkungan (physical evidence) yang
        nyaman dan asri dengan fasilitas yang lengkap, informasi yang lengkap dan
        terpercaya. Saat ini untuk meningkatkan minat beli, PT. Bin Daud karya maju
        melakukan promosi yaitu kepada pangkalan dan masyarakat tentang pemakaian
        tabung gas LPG 3 Kilogram yang bertujuan untuk mengurangi terjadinya kecelakaan
        pemakaian gas LPG 3 Kilogram. Program tersebut bertujuan memberikan pengertian
        dan pemahaman pada warga, agar masyarakat jangan kawatir menggunakan gas
        dengan catatan, harus mengikuti langkah-langkah yang tepat baik memilih tabung
        yang bagus, serta pemakaian aksesoris yang sesuai standar nasional.
        19
        Dari survai pendahuluan yang dilakukan diketahui bahwa akhir-akhir ini
        jumlah penjualan gas elpiji 3 kg di PT. Bin Daud Karya Maju dari bulan Januari-Juni
        2010 cenderung mengalami penurunan seperti tampak pada Gambar 1.1 di bawah ini:
        Tabel 1.1
        Jumlah penjualan gas elpiji 3 kg PT. Bin Daud Karya Maju
        Bulan Juli-Desember 2011
        Bulan Tabung (unit) % (Prosentase)
        Juni 33750 -7.56
        Agustus 31200 -0.13
        September 31158 -14.30
        Oktober 26702 31.45
        November 35100 -7.41
        Desember 32500

        Sumber: PT. Bin Daud Karya Maju Jambi, 2011
        Dari tabel 1.1 diatas dapat kita lihat bahwa penjualan bulan Agustus menurun
        dari bulan Juli yaitu 7,56% atau berkurang sebanyak 550 unit. Namun pada bulan
        Oktober sampai dengan bulan Nvember mengalami peningkatan yaitu 31,45%. Menurut
        Manajer Pemasaran PT. Bn Daud Karya Maju Jambi, menurunnya jumlah
        konsumen dapat disebabkan oleh harga dipasaran yang rendah, promosi yang
        mungkin masih kurang menarik, dan pelayanan yang kurang bagus. Oleh karena itu
        untuk mengurangi ketidakpastian jasa tersebut mereka akan menyimpulkan kualitas
        produk dari tempat, orang, peralatan, bahan-bahan komunikasi, simbol, dan harga
        yang mereka amati. Kesimpulan yang diambil para pelanggan akan banyak
        dipengaruhi oleh atribut-atribut yang digunakan perusahaan, baik atribut yang bersifat
        obyektif dan dapat dikuantitatifkan maupun atribut yang sangat subyektif dan bersifat
        perseptual.

        Berkaitan dengan hal tersebut diatas, maka perlu dilakukan suatu penelitian
        untuk menganalisis faktor-faktor yang mempengaruhi minat beli ulang konsumen
        dalam membeli gas elpiji 3 Kg. Pada tingkat selanjutunya diharapkan dapat
        meningkatkan jumlah konsumen. Maka dalam penelitian ini akan dibahas mengenai

        Perumusan Masalah

        Dari data yang ditunjukkan dalam tabel 1.1 diatas maka dapat kita lihat
        bahwa perusahaan gas elpiji 3 Kg PT. Bin Daud Karya Maju Jambi mengalami
        penurunan jumlah penjualan. Untuk itu, perusahaan perlu menganalisis faktor-faktor
        apa saja yang dapat menyebabkan pelanggan berminat untuk membeli ulang produk
        gas elpiji 3 Kg pada PT. Bin Daud Karya Maju Jambi.
        Berdasarkan latar belakang diatas terlihat adanya suatu masalah yaitu
        berkurangnya atau terjadinya penurunan jumlah penjualan PT. Bin Daud Karya Maju Jambi selama periode waktu 4 (empat) bulan. Berdasarkan hal tersebut maka
        dirumuskan permasalahan penelitian yaitu: “Bagaimana meningkatkan minat beli
        ulang gas elpiji 3 Kg pada PT. Bin Daud Karya Maju Jambi”.
        Pertanyaan penelitian yang hendak dijawab dalam penelitian ini adalah:
        1. Apa pengaruh harga terhadap minat beli ulang gas elpiji 3 Kg ?
        2. Apa pengaruh promosi terhadap minat beli ulang gas elpiji 3 Kg ?
        3. Apa pengaruh kualitas pelayanan terhadap minat beli ulang gas elpiji 3 Kg
        Tujuan penelitian

        Dari perumusan masalah diatas maka tujuan dari penelitian ini adalah:
        1. Untuk menganalisis dan menguji pengaruh harga terhadap minat beli ulang gas
        elpiji 3 kg.
        2. Untuk menganalisis dan menguji pengaruh promosi terhadap minat beli ulang gas
        elpiji 3 kg.
        3. Untuk menganalisis dan menguji pengaruh kualitas pelayanan terhadap minat beli
        ulang gas elpiji 3 kg
        Manfaat penelitian
        Sementara itu kegunaan dari penelitian ini adalah:
        1. TeoritisBagi ilmu pengetahuan, sebagai bahan tambahan referensi dan wacana
        khususnya yang berkaitan dengan masalah harga, promosi dan kualitas pelayanan
        serta minat beli ulang.
        2. PraktisBagi PT. Bin Daud Karya Maju Jambi hasil penelitian ini dapat digunakan
        sebagai masukan pihak manajemen PT. Bin Daud Karya Maju Jambi dalam pembuatan
        kebijakan penentuan harga, strategi promosi, peningkatan kualitas pelayanan, dan
        mengetahui perilaku konsumen terhadap minat beli ulang gas elpiji 3 Kg serta dapat
        memberikan kontribusi pada pengembangan teori yang berkaitan dengan minat beli
        ulang.

        BAB II

        METODE PENELITI AN

        Variabel Penelitian dan Definisi Operasional

        Variabel Penelitian

        Berdasarkan kerangka pemikiran dalam penelitian ini, maka variabel-variabel
        dalam penelitian ini adalah:
        a) Variabel independen (X)
        Merupakan variabel yang mempengaruhi atau yang menjadi sebab perubahannya
        atau timbulnya variabel dependen (Sugiyono, 2004). Variabel independen adalah
        harga (X1), promosi (X2), dan kualitas pelayanan (X3).
        b) Variabel dependen (Y)
        Merupakan variabel yang dipengaruhi atau yang menjadi akibat, karena adanya
        variabel bebas (Sugiyono, 2004). Dalam penelitian ini variabel dependen adalah
        minat beli ulang konsumen (Y).

        Y = minat beli ulang
        X1 = variabel harga
        X2 = variabel promosi
        X3 = kualitas pelayanan

        Definisi Operasional

        1. Variabel Harga
        Harga adalah sejumlah uang yang dibutuhkan untuk mendapatkan sejumlah
        kombinasi dari barang Dalam penelitian ini akan dianalisis
        mengenai tanggapan konsumen terhadap harga dilihat dari:
        a. Harga produk yang dijual lebih murah dari pesaing.
        b. Pemberian potongan harga atau discount.
        c. Kesesuaian harga dengan kualitas produk
        2. Variabel Promosi
        Promosi adalah komunikasi yang persuasif, mengajak, mendesak, membujuk,
        menyakinkan. Promosi diukur berdasarkan indikator : (Soebari Martoatmodjo,
        2000)
        a. Membeli barang karena ajakan teman
        b. Tahu pembelian gas dari mulut ke mulut
        c. Sikap konsumen terhadap promosi gas 3 kg
        3. Variabel Kualitas Pelayanan
        Kualitas pelayanan adalah kegiatan dimana penjual memberikan pelayanan
        kepada pembeli sehubungan dengan jual beli atau jasa (Philip Kotler,1999).
        Pelayanan diukur berdasarkan indikator :
        a. Sikap dan perilaku pelayanan petugas sopan dan ramah.
        b. Pelayanan yang cepat.
        c. Pengetahuan petugas terhadap barang yang ada
        4. Variabel minat ulang beli konsumen
        Minat membeli merupakan aktivitas psikis yang timbul karena adanya perasaan
        (afektif) dan pikiran (kognitif) terhadap suatu barang atau jasa yang diinginkan.
        Minat beli ulang diukur berdasarkan indikator :
        a. Menginformasikan kepada orang lain
        b. Kemauan untuk merekomendasikan kepada orang lain
        c. Kemauan untuk membeli kembali

        Populasi dan Sampel

        Populasi

        Populasi adalah wilayah generalisasi yang terdiri atas: obyek atau subyek
        yang mempunyai kualitas dan katakteristik tertentu yang ditetapkan oleh peneliti
        untuk dipelajari dan kemudian ditarik kesimpulannya (Sugiyono, 2004). Dalam
        penelitian ini yang menjadi populasi adalah konsumen yang membeli gas elpiji 3 Kg
        di PT. Bin Daud Karya Maju Jambi. Berdasarkan data terakhir perusahaan tahun
        2011 (31 Juli sampai dengan 30 Desember) adalah 150 orang konsumen (sumber:
        administrasi PT. Bin Daud Karya Maju Jambi). Penelitian ini dilakukan pada tanggal
        Desember 2011- januari 2012

        Sampel

        Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh
        populasi tersebut (Sugiyono, 2004). Untuk menentukan besarnya sampel tidak ada
        batasan yang mutlak atau tidak pasti dan jelas tentang sampel besar dan kecil. Ada
        beberapa faktor yang perlu dipertimbangkan untuk menentukan besarnya sampel:
        1. Derajat keseragaman dari populasi makin seragam populasi tersebut makin kecil
        sampel yang dapat diambil. Sebaliknya makin tidak seragam populasi itu makin
        besar sampel yang harus diambil.
        51
        2. Makin besar biaya, tenaga dan waktu yang tersedia akan semakin basar pula
        sampel yang dapat diambil. Penentuan jumlah sampel yang diperlukan dihitung
        berdasarkan rumus Solvin (Umar, 2000) sebagai berikut:

        n=N/(1+Ne²)………………………………….1

        Keterangan:
        N = Jumlah populasi
        n = sampel
        e = maksimal error/prosentase kelonggaran ketidaktelitian karena kesalahan
        pengambilan sampel yang masih dapat ditorerir atau diinginkan, yaitu 10%.
        Berdasarkan data yang diperoleh, dapat diketahui bahwa jumlah populasi
        konsumen PT. Bin Duad Karya Maju Jambi tahun 2011 sebanyak 150 konsumen. Dengan
        rumus diatas dapat dihitung besarnya sampel sebagai berikut:

        n=150/(1+150(0,1)²)
        n=150/2,5
        n = 60
        Berdasarkan hasil perhitungan diatas maka besarnya sampel yang dibutuhkan dalam
        penelitian ini adalah 60 orang responden.
        Cara menarik sampel yang digunakan dalam penelitian ini adalah dengan
        menggunakan tehnik stratified random sampling. Stratified random sampling adalah
        tehnik penarikan sampel yang dilakukan secara acak distratifikasi untuk memperoleh
        52
        jumlah sampel yang dapat mewakili karakteristik dari populasi penelitian.
        Pengambilan sampel secara acak dilakukan dengan diundi, dengan sistem without
        replacement (pemilihan anggota sampel tanpa pengembalian).
        Tabel 3.1 : Proporsi Sampel Setiap Bagian

        No Pembelian Dlm1Minggu jumlah proporsi sampel
        1 ≥ 37 (37/160)x100%=23,1% 23,1%x60=14
        2 < 123 (123/160)x100%=76,9% 76,9%x60=46
        160 60

        Jenis dan Sumber Data

        Jenis dan sumber data yang digunakan dalam penelitian ini adalah data
        primer. Data primer adalah data yang berasal langsung dari sumber data yang
        dikumpulkan secara khusus dan berhubungan langsung dengan permasalahan yang
        diteliti (Emory dan Cooper, 1991). Data primer dalam penelitian ini adalah tanggapan
        responden mengenai harga, promosi, kualitas pelayanan dan minat beli ulang.
        Responden dalam penelitian ini adalah konsumen dari PT. Bin Daud Karya Maju Jambi.

        Metode Pengumpulan Data

        Wawancara

        Wawancara adalah proses memperoleh keterangan untuk tujuan penelitian
        dengan cara tanya jawab langsung sambil bertatap muka (Dajan, 1986). Wawancara
        dilakukan dengan menggunakan daftar pertanyaan, dan merupakan cara memperoleh
        data yang bersifat langsung

        Komentar oleh Nanda regen | Januari 24, 2012

  68. Tugas Individu
    Nama : Asset Winardi
    NIM : ERC1B009025
    Kelas Ekstensi Sore

    Judul : “ANALISIS FAKTOR PERILAKU KONSUMEN TERHADAP KEPUTUSAN PEMBELIAN PRODUK AIR MINUM DALAM KEMASAN MEREK ARTHES”. (STUDI PADA KONSUMEN DI KELURAHAN KENALI BESAR)

    mohon di balas pak, thks

    Komentar oleh assetwinardi | Desember 27, 2011 | Balas

  69. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL : “Pelaksanaan Promosi Dalam Upaya Memelihara Loyalitas Pelanggan Pada PT. INDOSAT Cabang JAMBI”.

    Komentar oleh Rahmat | Desember 27, 2011 | Balas

  70. Judul Skripsi : PENGARUH PENCANTUMAN LABEL HALAL PADA PT. FASTFOOD INDONESIA Tbk (KFC) TERHADAP PERILAKU PEMBELIAN MASYARAKAT MUSLIM DI KOTA JAMBI

    Mohon sarannya pak..

    Komentar oleh INDAH INTAN SARI | Desember 27, 2011 | Balas

  71. Nama : Indah Intan Sari
    Nim : ERC1B009080

    Judul skripsi : PENGARUH PENCANTUMAN LABEL HALAL PADA PT. FASTFOOOD INDONESIA Tbk (KFC) TERHADAP PERILAKU PEMBELIAN MASYARAKAT MUSLIM DI KOTA JAMBI

    Mohon sarannya pak..

    Judul boleh, tapi adakah permsalahan aktual yg anda bisa kemukakan?

    Komentar oleh INDAH INTAN SARI | Desember 27, 2011 | Balas

    • Terimakasih atas sarannya pak. Tapi maaf pak sebelumnya , maksud yg bapak inginkan dari masalah aktual itu seperti apa ya pak ? Mohon penjelasannya pak.

      Masalah aktual maksudnya, permasalahan yg samapai saat ini anda bisa amati terjadi sesuai dg objek penelitian.

      Komentar oleh INDAH INTAN SARI | Desember 27, 2011 | Balas

      • Menurut saya pak, masalah aktual yang berhubungan dengan objek penelitian saya, kebanyakan orang muslim khusunya di kota Jambi jika ingin membeli (mengkonsumsi) suatu produk hal pertama yg dilihat adalah pencantuman label halal nya, karena jika tidak ada label halal yg dicantumkan pembeli yg beragama muslim akan ragu untuk membeli (mengkonsumsi) produk itu , dan sebaliknya pembeli tersebut tidak ragu-ragu untuk mengkonsumsi produk kfc jika terdapat lebel halal..

        Mohon sarannya pak apakah masalah aktual yg saya tulis sudah tepat. Terimakasih pak

        Indah, silahkan menulis proposal tentatif. Di latar belakang cari referensi yg lebih kuat mengemukakan pendapat sehingga posisi latar belakang dapat meyakinkan.

        Komentar oleh INDAH INTAN SARI | Desember 28, 2011

  72. TUGAS I (INDIVIDU)
    NAMA : Marissa Husna
    NIM : ERC1B009015
    Kelas ekstensi siang

    judul : Analisis Kualitas Jasa pada Divisi Gangguan PT. PLN Cabang Kota Jambi

    Tolong sarannya Pak,mksh

    Coba pertimbangkan yg ini. Analisis Kualitas Pelayanan Gangguna …..

    Komentar oleh Marissa Husna ERC1B009015 | Desember 27, 2011 | Balas

  73. TUGAS I (INDIVIDU)
    NAMA : ALFRED NANDO S
    NIM : C1B009128
    MGT G’09

    Judul : “ Pengaruh saluran distribusi dan promosi guna meningkatkan penjualan produk Multicare pada distributor cabang jambi ”

    Alfred saya sarankanjangan pengaruh saluran, tapi analisis fungsi saluran …..

    Komentar oleh Alfred Nando | Desember 27, 2011 | Balas

    • Pak, ini perbaikan judul dan proposal tentif saya. Maaf sebelumnya pak, karena terlambat memperbaikinya.
      JUDUL : “ Pengaruh pemasaran langsung terhadap keputusan beli konsumen produk Multicare pada distributor cabang jambi ”

      BAB I
      PENDAHULUAN

      1.1 Latar Belakang Masalah
      Dunia bisnis dewasa ini diwarnai oleh persaingan perusahaan di berbagai industri untuk lebih tanggap kepada kebutuhan konsumennya. Seiring dengan arus globalisasi, perkembanngan teknologi komunikasi dan informasi, kebutuhan dan harapan konsumen juga semakin meningkat. Adanya teknologi yang mendukung proses pengembangan produk yang semakin cepat dan sistem industri yang semakin fleksibel berakibat pada beraneka ragam produk yang ditawarkan oleh produsen untuk memenuhi kebutuhan konsumen yang semakin beragam.
      Dalam bisnis, produk adalah barang atau jasa yang dapat diperjualbelikan. Dalam marketing, produk adalah apapun yang bisa ditawarkan ke sebuah pasar dan bisa memuaskan sebuah keinginan atau kebutuhan. Dalam memasarkan suatu produk dibutuhkan konsep marketing mix, marketing mix merupakan bauran (mix) yakni interaksi dari empat hal , yaitu produk (product), harga (price), promosi (promotion) dan saluran distribusi (place).
      Promosi adalah suatu usaha dari pemasar dalam menginformasikan dan mempengaruhi orang atau pihak lain sehingga tertarik untuk melakukan transaksi atau pertukaran produk barang atau jasa yang dipasarkannya. Adapun tujuan dari pada perusahaan melakukan promosi adalah menginformasikan (informing), mempengaruhi dan membujuk (persuading) serta mengingatkan (reminding) pelanggan tentang perusahaan dan bauran pemasarannya. Tujuan promosi adalah empat hal, yaitu memperkenalkan diri, membujuk, modifikasi dan membentuk tingkah laku serta mengingatkan kembali tentang produk dan perusahaan yang bersangkutan. Dalam melakukan promosi agar dapat efektif perlu adanya bauran promosi, yaitu kombinasi yang optimal bagi berbagai jenis kegiatan atau pemilihan jenis kegiatan promosi yang paling efektif dalam meningkatkan penjualan.
      Salah satu bauran promosi yang ada adalah pemasaran langsung, pemasaran langsung merupakan bentuk promosi dengan cara memasarkan barang/jasa secara langsung agar mendapat tanggapan secara langsung juga dari para konsumen. Pemasaran langsung tidak harus bertatap muka secara langsung tetapi pemasaranya ditujukan secara langsung kepada seseorang. Pemasaran langsung bisa melalui penggunaan surat, telepon, faksimil, e-mail, dan alat penghubung nonpersonal lain untuk berkomunikasi secara langsung dengan atau mendapatkan tanggapan langsung dari pelanggan dan calon pelanggan tertentu.
      Pemasaran langsung dapat diatur waktunya untuk menjangkau calon pembeli pada saat yang tepat, bahan-bahan pemasaran langsung memiliki pembaca yang lebih tinggi karena bahan tersebut dikirimkan kepada calon yang lebih berminat. Pemasaran langsung juga membuat tawaran dan strategi pemasar langsung kurang terlihat bagi pesaing.
      Sedangkan proses keputusan pembelian konsumen merupakan suatu keputusan yang melibatkan pilihan alternatif dalam proses pengintegrasian yang mengkombinasikan pengetahuan untuk mengevaluasi alternatif-alternatif dan memilih salah satu diantaranya. Proses pengambilan keputusan pembelian tersebut terdiri dari: pengenalan akan kebutuhan, pencarian informasi, evaluasi alternatif, keputusan pembelian, dan perilaku pasca pembelian.
      Tujuan utama dari sebuah perusahaan ialah pencapaian profit (laba) dan hal ini dapat juga sebagai tolak ukur dalam sukses atau tidaknya sebuah perusahaan dalam pencapaian tujuannya. Selain itu efektifitas dan efisiensi dalam menjalankan operasional perusahaan juga memegang peranan penting. Efesiensi yang dimaksud adalah strategi pemasaran yang dilakukan dengan perhitungan dan pertimbangan yang tepat sehingga tidak ada pemborosan biaya baik itu dalam operaional maupun dalam biaya promosi maupun iklan dan efektifitas yang dimaksud ialah pemilihan stategi pemasaran yang tepat dan sesuai dengan pasar yang dilayani oleh perusahaan sehingga sasaran yang ditetapkan dapat tercapai.
      Multicare merupakan perusahaan yang bergerak di jalur bisnis Direct Selling Multilevel Marketing. Perusahaan ini juga termasuk salah satu perusahaan MLM yang terbaik dan terbesar di Indonesia. Dalam perjalanan usahanya, Multicare telah berkembang luas hingga ke seluruh pelosok Nusantara dengan dukungan puluhan Distribution Center (DC) guna melayani puluhan ribu anggota dari Sabang sampai Merauke. Distribution Center (DC) adalah mitra bisnis Multicare yang membantu pendistribusian produk dan informasi kepada mitra-mitra bisnis Multicare yang ada di daerahnya. Mereka memiliki komitmen pada Multicare dengan tingkat tertentu dan telah memenuhi semua persyaratan yang ditetapkan.
      Dari uraian di atas, penulis tertarik untuk mengetahui bagaimanakah pengaruh pemasaran langsung yang dijalankan oleh Distributor Center Cabang Jambi dalam menghadapi persaingan bisnis. Oleh karena itu, penulis akan melakukan penelitian dengan judul, “ PENGARUH PEMASARAN LANGSUNG TERHADAP KEPUTUSAN BELI KONSUMEN PRODUK MULTICARE PADA DISTRIBUTOR CABANG JAMBI ”.

      1.2 Rumusan Masalah
      Berdasarkan uraian pada latar belakang, maka yang menjadi pokok permasalahan dalam penelitian ini adalah Bagaimana Pengaruh pemasaran langsung terhadap keputusan beli konsumen produk Multicare pada distributor cabang jambi ?

      1.3 Tujuan Penelitian
      Tujuan dari penelitian ini adalah untuk Menganalisis Pengaruh pemasaran langsung terhadap keputusan beli konsumen produk Multicare pada distributor cabang jambi.

      1.4 Manfaat Penelitian
      Manfaat penelitian ini adalah :
      1. Bagi perusahaan terkait, hasil penelitian dapat dijadikan sebagai bahan pertimbangan bagi perencana pemasaran dalam usaha memajukan dan meningkatkan penjualan terhadap produk yang dipasarkan.
      2. Dapat bermanfaat bagi peneliti dalam meningkatkan kemampuan menganalisis terhadap suatu masalah serta memecahkan dengan metode-metode yang ilmiah.

      BAB II
      METODE PENELITIAN

      3.1 Variabel Penelitian
      Metode penelitian merupakan suatu kegiatan pengumpulan, pengolahan, penyajian dan analisa data yang dilakukan dengan metode ilmiah secara efisien dan sistematis yang hasilnya berguna untuk mengetahui suatu keadaan atau persoalan dalam rangka pemecahan masalah.
      Variabel yang akan digunakan dalam penelitian ini adalah :
      1. Variabel bebas / independent ( X) adalah pemasaran langsung, berupa : Surat langsung (X1), Pemasaran katalog (X2), dan Kunjungan penjualan lapangan (X3).
      2. Variabel terikat / dependent (Y) adalah keputusan membeli produk.

      3.2 Definisi Operasional Variabel
      3.2.1 Surat langsung (X1)
      Adalah pengiriman tawaran, pemberitahuan, alat pengingat, atau sesuatu yang lain kepada seseorang berupa surat, selebaran, dan brosur. Surat langsung merupakan satu medium yang populer karena surat langsung memungkinkan selektivitas pasar sasaran, dapat dipersonalisasikan, dan memungkinkan pengujian dini dan pengukuran tanggapan.
      3.2.2 Pemasaran katalog (X2)
      Merupakan pengiriman katalog barang dalam bentuk cetakan/majalah tetapi juga terkadang berupa kaset video/CD. Pemasaran katalog berusaha mengelola daftar pelaggan dengan hati-hati, mengendalikan persediaan dengan hati-hati, menawarkan barang dagangan yang bermutu, dan memproyeksikan citra yang jelas.
      3.2.3 Kunjungan penjualan lapangan (X3)
      Bentuk asli paling tua dari pemasaran langsung adalah kunjungan penjualan lapangan, ini merupakan angkatan/tenaga penjualan yang bertugas untuk melokasikan calon, mengembangkan mereka menjadi pelanggan, dan menumbuhkan bisnis.
      3.2.4 Keputusan pembelian produk (Y)
      Merupakan suatu tindakan konsumen dalam usaha untuk memenuhi kebutuhannya mengkonsumsi prduk kesehatan/multicare diikuti oleh kepuasan yang dirasakan oleh konsumen tersebut.
      Dari variabel ini dapat ditentukan indikatornya antara lain :
      a. Menjatuhkan pilihan atau alternatif pada produk yang terbaik
      b. Pengambilan keputusan dilakukan secara sadar, rasional, obyektif dan terencana.
      c. Pembelian kembali.

      3.3 Lokasi Penelitian
      Lokasi penelitian ini dilakukan di kota Jambi, tepatnya pada kecamatan Telanaipura dan Jambi Selatan dimana terdapat konsumen yang membeli/mengkonsumsi produk multicare. Dengan asumsi jumlah dalam penelitian ini bahwa jumlah populasi terbatas.

      3.4 Populasi dan Sampel
      3.4.1 Populasi Penelitian
      Populasi adalah keseluruhan subyek/obyek penelitian. Sedangkan sampel adalah sebagian atau wakil populasi yang diteliti. Populasi adalah totalitas dari semua obyek atau individu yang akan diteliti yang mana memiliki karakteristik tertentu, jelas dan lengkap. Populasi dalam penelitian ini adalah masyarakat yang pernah mengkonsumsi atau pelanggan dari produk Multicare karena besar populasi tidak dapat diketahui secara pasti berapa jumlahnya, oleh karena itu sulit mencari berapa jumlah populasi yang tepat.
      3.4.2 Sampel Penelitian
      Sampel merupakan bagian dari populasi yang diambil melalui cara-cara tertentu yang juga memiliki karakteristik tertentu, jelas, dan lengkap yang dianggap bisa mewakili populasi. Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 40 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut pendapat ahli seperti yang dikemukakan oleh Gay (dalam Hasan, 2002:68), “Ukuran sampel minimum yang dapat diterima bisa dilihat berdasarkan pada desain atau metode penelitian yang digunakan, jika desain penelitiannya deskriptif-korelasional, maka sampel minimum adalah 30 responden.

      3.5 Metode Pengumpulan Data
      Adapun teknik pengumpulan data-data informasi dan penarikan sampel sebagai bahan untuk menganalisis maka penulis menggunakan teknik sebagai berikut :
      a. Studi Kepustakaan
      Yaitu penelitian yang dilakukan dengan cara mempelajari dari buku-buku pengetahuan sebagai bahan literatur untuk memperoleh sumber data guna mendapatkan landasan teori yang benar.
      b. Studi Lapangan
      Yaitu dengan cara pengumpulan data-data pokok yang diperoleh secara langsung berdasarkan sumber dari lapangan, pengumpulan data ini dilakukan dengan cara :
       Wawancara, yaitu berupa tanya jawab dengan pihak yang terkait dengan objek penelitian.
       Quisioner, yaitu pengumpulan data dengan cara melalui angket yang berisi pertanyaan yang diisi oleh responden
      Data yang digunakan untuk menunjang penelitian ini menurut jenisnya adalah :
       Data primer
      Adalah data yang dipoleh langsung melalui wawancara dan quisioner konsumen.
       Data sekunder
      Adalah data yang diperoleh secara langsung melalui studi kepustakaan dan laporan yang berkaitan dengan masalah yang akan diteliti.
      Adapun sumber-sumber data tersebut adalah sebagai berikut :
      a. Responden, yaitu orang yang dapat memberikan keterangan tentang dirinya sendiri yang mempunyai keterkaitan langsung dalam pengambilan keputusan pembelian, dalam hal ini responden adalah konsumen.
      b. Catatan-catatan dokumen tertulis yang memberikan informasi yang berhubungan dengan penelitian yang akan diteliti.

      DAFTAR PUSTAKA :

      Arikunto,Suharsimi.2002. Prosedur Penelitian. Edisi Revisi V.PT.Rineka Cipta.Jakarta.
      Hasan, Iqbal. 2002. Pokok-Pokok Materi Statistik II: Statistik Inferensial. Bumi Aksara. Jakarta.
      Kotler, Philip dan Keller, Kevin Lane. 2007. Manajemen Pemasaran. Jilid 2.PT INDEKS. Jakarta.
      Sugiyono. 2004. Metode Penelitian Bisnis. Cetakan Pertama. CV. Alpha Beta. Bandung.

      Komentar oleh Alfred Nando | Januari 23, 2012 | Balas

  74. TUGAS INDIVIDU
    NAMA : M. RIVAN
    NIM : C1B008136
    MGT G08 PAGI

    pak jo saya ganti judul

    judul :
    “FAKTOR YANG MEMPENGARUHI TURUNNYA PRODUKSI DAN KUALITAS MINUMAN DI KEDAI KOPI JAMBI ”

    Masalah kopinya ok saja, tapi yg perlu ditonjolkan adalah pembahasan.Misalnya saja preferensi pelanggan terhadap kopi tradisional jambi, sementara sampel diambil di kedai kopi. Perrjelas dulu idenya.

    Komentar oleh muhammad rivan | Desember 28, 2011 | Balas

    • oke pak ,d kedai kopi dk menjual kopi tradisional jambi pak .
      jadi kalo judul nya ” preferensi pelanggan di kedai kopi jambi” gmn pak ?

      Kedai Jambi ini artinya apa. Semua kedai yg ada di Prov.Jambi? apa itu tak terlalu luas. Ambil lingkup yg sederhana dan mudah dilaksanakan.

      Komentar oleh muhammad rivan | Desember 31, 2011 | Balas

      • kedai kopi itu coffe shop pak , seperti j-co , moco ,
        dan tdk luas pak , hanya 1 tempat ..
        saya bekerja disana , maka nya saya ambil lingkup dsni ..

        Komentar oleh muhammad rivan | Januari 5, 2012

  75. Tugas Individu
    nama : Mariaty Sitompul
    Nim : B1009015
    MGT A pagi

    pak kemaren saya lirim judul membahas pergantian nama novita hotel. maaf pak saya ngirimnya kebayakkan, bukan disengaja pak. kesalahan teknis.

    judul yang saya angkat sekarang ada 2 pak ..
    mohon komentarnya..

    judul 1 : analisis strategi pemasaran memanfaatkan trotoar jalan pada pedagang bandrek dalam menarik
    minat konsumen khususnya anak muda.

    judul 2 : analisis pengaruh faktor psikologis terhadap keputusan konsumen dalam memilih jasa pendidikan di LIA Jambi

    MAriaty, judul yg diajukan cukup satu. Kamuyg pilih mana yg paling dikuasai, baru saya memberikan masukan.

    Komentar oleh MARIATY SITOMPUL | Desember 28, 2011 | Balas

    • maksud saya mau minta saran ma bapak mana judul yg lebih baik diangkat sesuai dengan kriteria penilaian bapak…

      Komentar oleh Mariaty Sitompul | Desember 30, 2011 | Balas

      • saya lebih tertarik dengan judul 1, namun apakah judul tersebut berpontensial pak????

        Mariaty segera garap judul jadi proposal tentatif.

        Komentar oleh Mariaty Sitompul | Desember 30, 2011

  76. TUGAS INDIVIDU 1
    NAMA : YANOV ARUM K.P
    NIM C1B009078
    MGT B PAGI

    Pak jo saya mau ganti judul yaitu ,” Analisis promosi penjualan dan minat konsumen pada produk Blackberry dan Nokia di Jambi ”

    mohon saran nya ya pak ..

    Yanov, topik ini bagus saya tunggu proposal tentatifmu.

    Komentar oleh YANOV | Desember 28, 2011 | Balas

    • makasii paaak..

      Komentar oleh YANOV | Desember 30, 2011 | Balas

  77. NAMA : DEDY SUDARMADI
    NIM : ERC1B009057
    kelas sore manajemen

    JUDUL ” Persepsi masyarakat tentang produk handpone buatan Cina”

    mohon saranya pak

    Judulmu bagus, tapi ambil satu kasu saja bisa untuklangan mahasiwa sebagai pengguna handphone atau kalangan apa saja yang banyak menggunakan hp china. Silahkan buat proposal tentatif.

    Komentar oleh DEDY SUDARMADI | Desember 29, 2011 | Balas

    • ok pak terimakasi ya pak jo

      Komentar oleh DEDY SUDARMADI | Desember 31, 2011 | Balas

  78. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore

    JUDUL : “Pelaksanaan Promosi Dalam Upaya Memelihara Loyalitas Pelanggan Pada PT. INDOSAT Cabang JAMBI”.

    Rahmat, topikmu bagus. Tapi harus dipilih salah satu produk Indosat, jangan seluruhnya terlalu luas.

    Komentar oleh rahmat | Desember 29, 2011 | Balas

    • Terimakasih Pak,,,gimana kalao judulnya saya rubah menjadi

      “Pelaksanaan Promosi Dalam Upaya Memelihara Loyalitas Pelanggan Kartu Im3 Pada PT. INDOSAT Cabang JAMBI”.

      Judul bisa berubah misalnya. Efektifitas promosi untuk memelilhara loyalitas pelanggan. Silahkan tulis proposal tentatif.

      Komentar oleh Rahmat | Januari 3, 2012 | Balas

      • iya Pak jo,,,terimakasih

        Komentar oleh rahmat | Januari 5, 2012

  79. “maaf pak, judul saya ini blm bapak coment”

    TUGAS INDIVIDU

    NAMA : FREDY FRISTAMA
    NIM : ERC1B009060
    KELAS SORE MANAJEMEN

    JUDUL SKRIPSI : “Pengaruh pelaksanaan advertising yang efektif untuk meningkatkan volume penjualan pada hotel Abadi”

    Judul seperti ini terlalu normatif, kerjakannya susah. Kalau studi tentang keefektifan periklanan di Hotel Abadi mungkin masih lebih mudah untuk dilakukan.

    Komentar oleh Fredy Fristama | Desember 30, 2011 | Balas

    • Trimakasih Pak Jo. setelah saya pelajari lebih lanjut memang benar susah mengerjakannya, sehingga saya sulit mendapatkan titik temu.
      jadi saya ganti judul saya dengan : “PELAKSANAAN SALES PROMOTION MOBIL MEREK TOYOTA AVANZA
      PADA PT. ASTRA INTERNASIONAL (AUTO 2000) CABANG JAMBI”

      trimakasih atas bimbingannya Pk Jo..

      Komentar oleh Fredy Fristama | Januari 27, 2012 | Balas

  80. Nama : Asset Winardi
    NIM : ERC1B009025
    Judul Proposal Skripsi : “ANALISIS FAKTOR PERILAKU KONSUMEN TERHADAP KEPUTUSAN PEMBELIAN PRODUK AIR MINUM DALAM KEMASAN MEREK ARTHES”. (STUDI PADA KONSUMEN DI KELURAHAN KENALI BESAR)

    Mohon sarannya pak, terima kasih.

    Komentar oleh assetwinardi | Desember 30, 2011 | Balas

  81. maaf pak, sudah berulang kali saya kirim judul proposal skripsi saya belum bapak komentar, mohon saran dan komentarnya pak,

    Nama : Asset Winardi
    NIM : ERC1B009025
    Judul Proposal Skripsi : “ANALISIS FAKTOR PERILAKU KONSUMEN TERHADAP KEPUTUSAN PEMBELIAN PRODUK AIR MINUM DALAM KEMASAN MEREK ARTHES”. (STUDI PADA KONSUMEN DI KELURAHAN KENALI BESAR)

    terima kasih pak.

    Winardi, pilihlah variabel perilaku konsumen, baca bukunya. Kasus yg anda kemukakan saya setuju.

    Komentar oleh assetwinardi | Januari 3, 2012 | Balas

  82. BAB I
    PENDAHULUAN

    1.1 Latar Belakang Masalah
    Pada umumnya tujuan pokok yang ingin dicapai oleh perusahaan adalah untuk dapat menghasilkan laba, mengalami perkembangan dan menjaga kelangsungan hidup perusahaan. Dengan semakin berkembangnya dunia usaha maka semakin tajam pula tingkat persaingan antara sesama perusahaan. Martono dan Harjito (2001:2), mengatakan bahwa perusahaan memiliki tiga tujuan utama yang saling berkaitan, yaitu mencapai atau memperoleh laba maksimal untuk kemakmuran pemilik perusahaan, menjaga kelangsungan hidup perusahaan (going concern), mencapai kesejahteraan masyarakat sebagai tanggung jawab sosial perusahaan.
    Untuk meraih tujuan tersebut, perusahaan dapat menempuh jalur pemasaran. Salah satu strategi pemasaran yang dapat digunakan adalah sistem direct selling yang dapat mendistribusikan produk langsung ke tangan konsumen. Kekuatan dari sistem direct selling adalah tradisi kemandirian layanan ke konsumen dan komitmen untuk pertumbuhan kewirausahaan dalam sistem pasar bebas. Sistem direct selling menawarkan peluang usaha kepada mereka yang mencari alternatif untuk mendapatkan penghasilan tanpa melihat suku, jenis kelamin, tingkat pendidikan, umur maupun pengalaman. Sistem ini menawarkan peluang untuk mendapatkan penghasilan dengan bekerja paruh waktu maupun penuh waktu. Dalam banyak kasus, peluang direct selling ini berkembang menjadi suatu ‘karir’ yang memuaskan bagi mereka yang mencapai kesuksesan dan memilih untuk bekerja secara full time. Metode direct selling mempunyai kelebihan antara lain, operasinya lebih fleksibel karena penjual dapat mengamati reaksi pelanggan dan menyesuaikan pendekatannya, usaha yang sia-sia dapat diminimalkan, pelanggan yang berminat biasanya langsung membeli, dan penjual dapat membina hubungan jangka panjang dengan pelanggannya. Di dalamnya terkandung praktik salesmanship, negotiating, dan relationship marketing, yang sangat dibutuhkan di era persaingan pasar bebas. Selain itu, keuntungan lain dari sistem ini yaitu penjual dapat menikmati kebebasan waktu, kebebasan dalam menentukan keuntungan, memperoleh pelatihan gratis dari perusahaan/sponsor, dan memperbolehkan orang berbisnis dengan produk atau jasa yang unik dan inovatif, membawa mereka ke pasar tanpa mengeluarkan biaya iklan dan media massa yang sangat besar, dan tanpa harus bersaing di toko-toko pengecer.
    Di sisi pelanggan, biasanya penjual akan mendatangi langsung si calon pelanggan, sehingga mereka tidak perlu repot-repot keluar rumah. Mereka akan mendapatkan penjelasan akan produk sejelas-jelasnya, dan mereka juga bisa langsung menanyakan ketidakjelasannya ketika penjual sedang mempresentasikan produk yang dijualnya.
    Meskipun demikian, sistem direct selling juga menghadapi masalah-masalah seperti orang yang terganggu karena penjualan yang agresif, timbulnya citra buruk bagi industri bila ada salah satu penjual yang menipu pelanggannya, mengganggu privacy orang lain, dan kadangkala ada beberapa penjual yang memanfaatkan atau mengeksploitasi pembeli impulsif atau pembeli yang kurang mengerti teknologi. Selain itu, terdapat beberapa faktor lain yang menyebabkan kegagalan direct selling, antara lain manajemen yang buruk karena kurangnya pengalaman serta komitmen yang diperlukan, kurangnya komunikasi secara efektif dengan para distributor, serta kegagalan memotivasi para distributor. Produk-produk yang dijual mutunya rendah atau pasarnya terbatas. Uraian diatas memperlihatkan bahwa penggunaan sistem direct selling merupakan salah satu hal yang sangat penting peranannya dalam meningkatkan penjualan dan memperkuat posisi perusahaan di tengah–tengah persaingan serta mendorong perkembangan perusahaan, karena untuk mendorong perkembangan perusahaan, perusahaan harus mampu melakukan inovasi–inovasi baru terhadap produknya sehingga konsumen tidak bosan.
    PT. Yakult Indonesia Persada menggunakan strategi pemasaran yang dinamakan dengan sistem direct selling yang mendistribusikan produk secara langsung ke tangan konsumen. Sistem direct selling dalam PT. Yakult Indonesia Persada dinamakan dengan sistem Yakult Lady. Melalui sistem ini, Yakult didistribusikan oleh ibu-ibu rumah tangga kepada masyarakat di lingkungan tempat tinggal mereka. Ketika melayani masyarakat, Yakult Lady juga melakukan propaganda yang berisi tentang penjelasan mengenai manfaat Yakult. Yakult Lady disini merupakan peranan agen yang mendistribusikan langsung produknya ke tangan konsumen. Peranan agen penjualan merupakan salah satu stategi pemasaran yang sangat penting dalam PT. Yakult Indonesia Persada. PT. Yakult Indonesia Persada merupakan usaha patungan dengan status Penanaman Modal Asing (PMA) antara PT. Perkasa Simpati Persada dan Yakult Honsha Co.Ltd. (Jepang). Secara komersial Yakult mulai diproduksi pada tanggal 1 Januari 1991 dari pabrik di Jl. Kiwi Pekayon Pasar Rebo Jakarta. Pada tahun 1997 lokasi pabrik di Pasar Rebo yang kapasitas produksinya 720.000 botol per hari dipindahkan ke Desa Pesawahan, Cicurug, Sukabumi, Jawa Barat dan kapasitas produksi ditingkatkan menjadi 1.800.000 botol per hari. Pada bulan Desember 2001 PT. Yakult Indonesia Persada menjadi PMA murni dengan permodalan dari Yakult Honsha Co. Ltd dan Yakult Management Service Co.Ltd di Jepang.
    Produk minuman kesehatan Yakult sangat sensitif terhadap temperatur. Perubahan temperatur sangat berpengaruh terhadap bakteri Lactobacillus casei yang terdapat dalam minuman Yakult. Bakteri Yakult harus dipertahankan hidup. Karenanya harus diusahakan agar setelah dibotolkan, bakteri-bakteri tersebut tidak lagi melakukan proses fermentasinya. Untuk itu Yakult harus selalu disimpan didalam pendingin (dibawah 10°C) karena penyimpanan didalam pendingin akan menjaga bakteri Yakult tetap non aktif. Berkenaan dengan itu untuk menjaga mutunya, distribusi Yakult ditangani langsung oleh staff perusahaan.
    Melihat bahwa pada kenyataannya sistem direct selling dapat mempertemukan agen-agen penjualan langsung kepada pembeli/pelanggan, dan hal tersebut mempunyai peranan yang penting dalam menciptakan permintaan yang berguna untuk meningkatkan volume penjualan, maka penulis tertarik membahas hal tersebut dalam bentuk skripsi dengan judul: “Peranan Yakult Lady Dalam Upaya Meningkatkan Volume Penjualan Pada PT. Yakult Indonesia Persada Cabang Jambi“.

    1.2 Perumusan Masalah
    Berdasarkan latar belakang yang telah dikemukakan sebelumnya maka penulis merumuskan masalah sebagai berikut: “Apakah peranan yakult lady berpengaruh terhadap peningkatan volume penjualan pada PT. Yakult Indonesia Persada Cabang Jambi?”.

    1.3 Tujuan Penelitian
    Tujuan penelitian ini adalah :
    Untuk mengetahui dan menganalisis bahwa peranan Yakult Lady berpengaruh terhadap peningkatan volume penjualan pada PT. Yakult Indonesia Persada Cabang Jambi.

    1.4 Manfaat Penelitian
    a. Bagi Perusahaan
    Penelitian ini merupakan informasi bagi perusahaan untuk mengetahui keefektifan strategi pemasaran yang dilakukan dalam meningkatkan volume penjualan suatu produk.

    b. Bagi Pihak Lain
    Penelitian ini dapat digunakan sebagai referensi atau sumbangan pemikiran bagi pihak lain terutama bagi mahasiswa yang sedang melakukan penelitian selanjutnya khususnya mengenai peranan agen penjualan dengan volume penjualan.
    c. Bagi Penulis
    Penelitian ini dapat menambah wawasan dan pengetahuan penulis dalam bidang pemasaran terutama dalam memahami seberapa besar peranan agen penjualan dalam meningkatkan volume penjualan.

    Dodo, topikmu ini potensil untuk dilanjutkan karena belum banyak yg menulisnya. Dodo bisa mengambil kasus direct selling sebagai cara padang. Misalnya dg membuat judul “strategi pemasaran Yakult melalui Direct Selling”. PErbaiki latar belakang setidaknya harus ada tiga catatan kaki. Semua proses dicetak dan ini akan dijadikan bahan penilaian. Selanjutnya jelaskan populasi dimana? Lebih cepat lebih bagus.

    Komentar oleh Remmy Dodo Jandelli | Januari 4, 2012 | Balas

  83. Ma kasih pak jo…tapi masih bingung pak urutan proposal itu apa aja….kalo bisa ada satu contoh yang bisa kami jadikan panduan pak…terima kasih…..

    Komentar oleh Remmy Dodo Jandelli | Januari 4, 2012 | Balas

    • Waktu kuliah sudah dijelaskan urutannya, ikuti saja itu. Pak. Jo.

      ________________________________

      Komentar oleh johannessimatupang | Januari 4, 2012 | Balas

  84. TUGAS I (INDIVIDU)
    NAMA : NASRUDIN
    NIM : C1B008104
    MGT G’08

    Judul Proposal Skripsi :
    “Ananalisis strategi pemasaran triplex pada PT PSUT”

    Komentar oleh NASRUDIN | Januari 4, 2012 | Balas

  85. TUGAS I (INDIVIDU)
    NAMA :KISTON .P. HUTAURUK
    NIM : C1B008143
    MGT G’08

    Judul Proposal Skripsi :” Persepsi masyarakat tentang produk handpone MITO 855”

    Lokasi penelitian perlu disebut agar tak terlalu luas.

    Komentar oleh KISTON .P. HUTAURUK | Januari 4, 2012 | Balas

    • Maaf sebelum nya pak jo saya maumerubah judul yang sayaajukan padapak jo….
      menjadi……..

      “PENGARUH KUALITAS PELAYANANTERHADAP KEPUASAN KONSUMEN PADA HOTEL AMANAH JAMBI”

      Kalau ganti judul ok saja, tapi proposal tentatifmus segera. Kamis besok kita tatap muka di Ruang Seminar Manajemen.

      Komentar oleh KISTON. P. HUTAURUK | Januari 24, 2012 | Balas

      • BAB I
        PENDAHULUAN

        A. Latar Belakang Masalah Penelitian
        Kegiatan pemasaran saat ini menjadi sangat penting bagi usaha perhotelan, karena perhotelan merupakan salah satu usaha jasa pelayanan yang cukup rumit pengelolaannya dan menyediakan berbagai fasilitas yang dapat digunakan oleh tamu-tamunya selama 24 jam. Disamping itu, usaha perhotelan juga dapat menunjang kegiatan para usahawan yang sedang melakukan perjalanan usaha atau para wisatawan yang melakukan perjalanan untuk mengunjungi daerah-daerah tujuan wisata, membutuhkan tempat untuk menginap, makan dan minum serta hiburan. Oleh karena itu, hotel merupakan salah satu bentuk usaha bidang jasa yang mengedepankan kualitas pelayanan bagi para pelanggannya.
        Semakin tinggi tingkat persaingan, tingkat kompleksitas pasar dan tamu yang semakin kritis akan pasar mengakibatkan kegiatan pemasaran pada dunia bisnis perhotelan perlu dikelola secara profesional. Karena keberhasilan perusahaan di bidang jasa khususnya hotel, bergantung pada kemampuannya untuk memenuhi kebutuhan dan selanjutnya untuk memuaskan konsumen. Pada awalnya setiap tamu memiliki kebutuhan, keinginan, dan tujuan yang berbeda. Kenyataan ini mendorong timbulnya konsep pangsa pasar. Artinya kita berusaha mendapatkan sekelompok orang di pasar sasaran untuk memasarkan produk dan/atau jasa pelayanan hotel sesuai dengan harapan tamu sehingga konsumen akan merasa puas, dan akan terus menerus mengkonsumsi jasa pelayanan dari hotel tersebut.
        Kepuasan pelanggan adalah tingkat kesesuaian antara produk dan/atau jasa pelayanan yang diinginkan dengan kenyataan yang diterima. Tingkat kesesuaian tersebut adalah hasil penilaian yang dilakukan oleh tamu berdasarkan pada pengetahuan dan pengalamannya. Kepuasan pelanggan ditentukan oleh kualitas jasa yang dikehendaki sehingga jaminan kualitas menjadi prioritas utama dan dijadikan tolok ukur keunggulan daya saing perusahaan. Untuk memperoleh gambaran tentang kepuasan konsumen, maka perlu diketahui arti kualitas pelayanan.
        Kualitas pelayanan adalah sesuatu yang komplek terdiri dari lima unsur, yaitu: Reliabilitas, Responsiveness, Assurance, Empathy, danTangible. Buruknya kualitas jasa yang diberikan penyedia jasa kepada pelanggan telah disadari mengakibatkan banyaknya kerugian yang dialami oleh perusahaan. Mereka yang kecewa tidak hanya meninggalkan perusahaan, tetapi juga akan menceritakan keburukan jasa yang diterima kepada orang lain. Selain itu perusahaan akan lebih banyak mengeluarkan biaya untuk mendapatkan satu orang pelanggan baru. Kurangnya kualitas jasa dibidang ekonomi merupakan harga tertinggi yang tumbuh sangat cepat, dari pada harga produk nyata.
        Bila dalam usaha perhotelan mampu menciptakan kepuasan pelanggan, maka kepuasan pelanggan dapat memberikan manfaat diantaranya hubungan antara perusahaan dan pelanggannya menjadi harmonis, memberikan dasar yang baik bagi pembelian ulang dan terciptanya loyalitas pelanggan, serta membentuk suatu rekomendasi dari mulut ke mulut (word of mouth) yang menguntungkan bagi perusahaan.
        Hal ini disebabkan konsumen yang datang ke Hotel Amanah jambi mempunyai motivasi atau pendorong yang berbeda dalam memanfaatkan produk jasa yang ditawarkan apakah menyewa kamar, memanfaatkan fasilitas yang ada seperti fasilitas rapat, hiburan dan lainnya, keistimewaan-keistimewaan yang ditawarkan oleh pihak Hotel nantinya akan menjadi suatu indikator bagi kepuasan konsumen sehingga pihak perusahaan perlu meningkatkan kualitas jasanya.
        Berdasarkan latar belakang tersebut, maka judul penelitian adalah “Analisis Pengaruh Kualitas Pelayanan Terhadap Kepuasan Konsumen Pada Hotel Amanah jambi”.
        B. Rumusan Masalah
        Berdasarkan uraian latar belakang di atas, maka dapat dirumuskan masalah sebagai berikut:
        1. Apakah Variabel kualitas pelayanan yang terdiri dari: (Reliabilitas, Responsiveness, Assurance, Empathy, dan Tangible) berpengaruh terhadap kepuasan konsumen pada Hotel Amanah jambi ?
        2. Di antara variabel tersebut yang meliputi (Reliabilitas, Responsiveness, Assurance, Empathy, dan Tangible) manakah yang berpengaruh dominan terhadap kepuasan konsumen pada Hotel Amanah jambi ?

        C. Tujuan Penelitian
        Agar peneliti mempunyai arah yang jelas, maka ditetapkan tujuan penelitian sebagai berikut:
        1. Untuk mengetahui pengaruh kualitas pelayanan yang terdiri dari: (Reliabilitas, Responsiveness, Assurance, Empathy, dan Tangible)terhadap kepuasan konsumen pada Hotel Amanah jambi?
        2. Untuk mengetahui variabel kualitas pelayanan manakah yang berpengaruh dominan terhadap kepuasan konsumen pada Hotel Amanah jambi?
        D. Kegunaan Penelitian
        1. Bagi Penulis
        Untuk mengetahui penerapan teori yang diperoleh dibangku kuliah dengan realita yang terjadi di lapangan, mengenai masalah-masalah yang ada dalam pemasaran khususnya tentang variabel pelayanan yang berpengaruh terhadap kepuasan pelanggan.

        2. Bagi Perusahaan
        Sebagai bahan pertimbangan bagi perusahaan dalam membuat kebijaksanaan untuk memecahkan masalah kualitas pelayanan yang sedang dihadapi perusahaan.
        3. Bagi Peneliti Lain
        Hasil penelitian ini dapat digunakan sebagai bahan referensi atau acuan bagi peneliti berikutnya dan menindaklanjuti dengan penelitian yang baru.
        BAB II
        A. Obyek / Populasi Penelitian
        Dalam penulisan skripsi ini yang menjadi obyek penelitian adalah hotel amanah di Jambi. Sedangkan subyek/populasi dari penelitian ini adalah pengunjung (tamu ) pada hotel amanah Jambi.
        B. Jenis Data
        Data yang digunakan dalam penelitian ini adalah data primer, yang diperoleh langsung dari responden.
        C. Metoda Pengumpulan Data
        Untuk memperoleh data yang relevan terhadap penelitian ini, maka penulis menggunakan wawancara sebagai alat pengumpulan data. Wawancara secara langsung pada pengunjung hotel.
        D. Teknik Pengambilan Sampel
        Sampel adalah sebagian dari populasi yang diteliti. Teknik sampling dalam penelitian ini adalah metode convenience sampling (sampling kemudahan) yaitu pengambilan sampel dari pengunjung yang datanya mudah diperoleh oleh peneliti (Soehardi, S 1999). Sehingga peneliti memiliki kebebasan untuk memilih sampel yang paling cepat dan murah. Jumlah sampel yang diambil adalah 100 pengunjung karena berdasarkan tingkat keyakinan peneliti bahwa 100 pengunjungsudah cukup mewakili dari populasi

        Komentar oleh :KISTON .P. HUTAURUK | Januari 25, 2012

  86. Pak, ada sedikit perubahan judul, agar lebih signifikan saya ganti dengan
    “PENGARUH STRATEGI PEMASARAN SWALAYAN KEMBANG TURI AGUNG PADA TINGKAT KONSUMSI KONSUMEN DI WAKTU TERTENTU”

    dan dengan latar belakang penjelasan strategi pemasaran yang sudah bapak sarankan

    1.1 Latar Belakang Masalah
    Seiring dengan perkembangan ekonomi yang mempunyai beragam aktivitas pemasaran dan kebudayaan yang ada pada masyarakat membawa dampak pada pola perilaku belanja konsumen, maka tuntutan akan tempat berbelanja yang nyaman dan dapat menyediakan segala kebutuhan konsumen dalam satu swalayan semakin dibutuhkan.
    Perkembangan swalayan dan tingkat konsumsi konsumen yang terus berlangsung hendaknya dapat disadari oleh para wirausaha untuk dijadikan peluang, dengan memperhatikan pola perilaku konsumsi konsumen pada kebudayaan yang telah ada dan mengimplementasikannya terhadap strategi pemasaran dengan menawarkan pelayanan dan harga harga yang varian sehingga menarik minat konsumen untuk membeli khususnya pada waktu-waktu tertentu yang sudah menjadi bagian dari kebudayaan masyarakat sekitar seperti pada hari-hari besar idul fitri, natal.
    Mengenali pola konsumtif konsumen sangatlah menguntungkan bagi swalayan untuk dapat tetap bersaing dan survive (kelangsungan hidup perusahaan). Dengan melihat keterkaitan antara tingkat konsumsi konsumen pada saat tertentu akan menjadi sangat efektif bila menjadikannya peluang dan dihubungkan dengan kegiatan pemasaran, pastinya dengan menyadari dan memahami kebudayaan tersebut dan pola konsumsi masyarakat di waktu sebelumnya.
    Strategi pemasaran hendaknya dilakukan dengan perhitungan dan pertimbangan yang tepat sehingga tidak ada pemborosan biaya baik itu dalam operasional maupun dalam biaya promosi atau iklan dan efektifitas yang dimaksud ialah pemilihan stategi pemasaran yang tepat dan sesuai dengan keadaan pasar sehingga sasaran yang ditetapkan dapat tercapai, seperti pada swalayan penelitian ini akan difokuskan kepada strategi pemasaran dengan kelengkapan berbagai macam barang dan penataan barang yang kemudian akan mempengaruhi konsumsi konsumen terhadap waktu tertentu.

    Komentar oleh wulan16 | Januari 4, 2012 | Balas

  87. BAB I
    PENDAHULUAN

    A. Latar Belakang Masalah
    Ada banyak alasan mengapa minimarket begitu memukau dan menyedot konsumen untuk berdatangan, yaitu selain tempatnya yang nyaman (sejuk, bersih, dan luas), lokasi yang stategis (berada pada pusat kota),harga yang diberikan pun sangat bersaing dan tidak kalah pentingnya yaitu pilihan produknya yang juga begitu banyak.Di dalam minimarket kita bisa mendapatkan mulai dari keperluan dapur hingga furniture , kebutuhan rumah tangga hingga perlengkapan kantor, dan produk fashion ataupun barang-barang elektronik.Waktu operasinya juga panjang hingga pukul 21.00 bahkan sesekali,menjelang Lebaran dan Tahun Baru, minimarket buka hingga 24 jam.Beberapa minimarket juga membuka layanan antar sehingga pelanggan benar-benar telah menjadi raja.
    Minirmarket yang baru muncul sekitar beberapa tahun yang lalu, sudah terasa sangat akrab di dalam benak masyarakat Indonesia. Bahkan mulai merebut hati pelanggan melebihi toko -toko grosir tradisional.Telah diketahui bahwa pasar Indonesia merupakan pasar yang sangat potensial untuk memasarkan produk dan jasa.Konsumen Indonesia cukup cepat menerima masuknya suatu hal baru, seperti semakin maraknya mal- mal dan pasar swalayan di beberapa kota di Indonesia menjadi suatu hal yang sangat menarik untuk dimasuki oleh para pemasar.Seiring dengan semakin banyaknya gerai minimarket di Indonesia,maka semakin kecil pangsa pasar yang dimiliki oleh masing- masing minirmarket. Kesuksesan minimarket adalah minimarket yang mampu memenangkan pilihan pelanggan dan mempertahankannya. Jambi merupakan tempat yang paling cocok untuk pengembangan bisnis ritel,karena sebagian penduduknya adalah pendatang yang mempunyai kesibukan tersendiri,misalnya adalah sekolah,kuliah,dan kerja.Dengan adanya minimarket seperti Tunas Harapan Jaya maka akan sangat membantu mereka para pendatang,dan sebaliknya bagi Tunas Harapan Jaya akan cepat berkembang karena pertumbuhan penduduk Jambi, khususnya di daerah Kebun Kopy sangat cepat dan juga modern sehingga kemungkinan masyarakat untuk berbelanja di minimarket sangat besar.
    Dalam melakukan pemilihan tempat berbelanja,konsumen akan melihat beberapa dimensi atau faktor-faktor tertentu yang menunjukkan bahwa tempat belanja tersebut dapat memenuhi kebutuhannya baik secara material maupun psikologis yang nantinya akan membawa pada tingkat loyalitas pelanggan terhadap minimarket.Minimarket yang merupakan tempat berbelanja yang sangat diminati oleh konsumen di era modern ini,harus memiliki karakteristik tertentu yang membedakan dengan minimarket atau supermarket lain sehingga konsumen tertarik untuk mengunjunginya dan bertransaksi didalamnya.Demi menarik minat konsumen agar berkunjung dengan sendirinya ke dalam minimarket,maka sebuah minimarket harus membentuk suatu citra yang baik mulai dari segi tampilan fisik, pelayanan hingga suatu citra khas yang telah menjadi konsep minimarket tersebut.
    Pentingnya sebuah citra minimarket akan membawa perusahaan tersebut kepada kesuksesan dan kelangsungan hidupnya.Citra minimarket ini dapat dibentuk melalui berbagai dimensi yang kemungkinan besar akan selalu dilihat oleh para konsumen sebelum mereka berkunjung ke dalam sebuah minimarket.Dimana dengan dibentuknya dimensi-dimensi tersebut diharapkan para konsumen akan tertarik berkunjung ke dalam minimarket dan menjadi loyal terhadap minimarket.Oleh karena itu,dalam kesempatannya penulis melakukan sebuah penelitian dengan tema “Pengaruh Citra Minimarket Terhadap Loyalitas Pelanggan pada Tunas Harapan Jaya”.

    B. Perumusan Masalah
    Dalam memutuskan tempat belanja yang tepat,pelanggan akan melihat bagaimana citra sebuah minirmarket ataupun tempat belanja lainnya sebelum masuk ke dalamnya.Hal ini dilakukan karena pada umumnya pelanggan akan sangat selektif dalam memilih tempat belanjanya demi tujuan menciptakan loyalitas terhadap minimarket. Dari uraian di atas dan berdasarkan pada latar belakang masalah, maka perumusan masalah pada penelitian ini adalah sebagai berikut:
    1.Bagaimana pengaruh dimensi citra minimarket kelengkapan produk terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya? 2.Bagaimana pengaruh dimensi citra minimarket pelayanan terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?
    3.Bagaimana pengaruh dimensi citra minimarket kelengkapan fasilitas terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?
    4.Bagaimana pengaruh dimensi citra minimarket lingkungan fisik terhadap loyalitas pelanggan pada Minimarket Tunas HarapanJaya?
    5.Manakah variabel dimensi citra minimarket yang paling dominan berpengaruh terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?

    C.Tujuan Penelitian
    Adapun tujuan dari penelitian ini adalah sebagai berikut:
    1.Untuk mengidentifikasi pengaruh dimensi citra minimarket kelengkapan produk terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
    2.Untuk mengidentifikasi pengaruh dimensi citra minimarket pelayanan terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
    3.Untuk mengidentifikasi pengaruh dimensi citra minimarket kelengkapan fasilitas terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
    4.Untuk mengidentifikasi pengaruh dimensi citra minimarket lingkungan fisik terhadap loya litas pelanggan pada Minimarket Tunas Harapan Jaya.
    5.Untuk mengidentifikasi manakah variabel dimensi citra minimarket yang paling dominan berpengaruh terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.

    D.Manfaat Penelitian
    Ada beberapa manfaat dari penelitian ini,yaitu:
    1.Peneliti:dapat memperkaya pengetahuan tentang perilaku konsumen,dan mengaplikasikan konsep-konsep dan teori-teori mengenai citra minimarket dan loyalitas pelanggan khususnya pada “Minimarket Tunas Harapan Jaya”.
    2.Perusahaan:hasil penelitian ini dapat digunakan sebagai acuan pihak manajemen Minimarket Tunas Harapan Jaya untuk memenuhi kepentingan perusahaan terutama dalam menciptakan loyalitas pelanggan melalui citra minimarket.
    3.Komunitas akademik:memberikan literatur mengenai citra minimarket dan loyalitas pelanggan,khususnya pada industri ritel (eceran).

    Diberitahukan untuk semua, kalau mempost (upload) tugas janganlupa identitas, karena kita akan masuk tahap evaluasi. Jangan lupa menambahkan daftar pustaka

    Komentar oleh rachmat | Januari 5, 2012 | Balas

    • Nama : Rachmat Putra Chayadri
      Nim : ERC1B009069
      Kelas Ekstensi Sore

      Komentar oleh rachmat | Januari 7, 2012 | Balas

    • Mohon Sarannya pak pada latar belakang yang saya ajukan.terima kasih

      RAchmat, ditunggu tentatifmu.

      Komentar oleh rachmat | Januari 7, 2012 | Balas

      • iya terimakasih pak jo

        Komentar oleh rachmat | Januari 10, 2012

  88. NAMA : JONI HANTER. IMMANUEL
    NIM : ERC1B009066

    BAB 1

    PENDAHULUAN

    1.1 Latar belakang Penelitian

    Dalam perkembangan dunia teknologi pada akhir-akhir ini ditandai denagan semakin tajam nya persaingan yang ada, terutama antar perusahaan yang menghasilkan produk-produk yang sejenis. Hal ini memotivasi produsen untuk terus berinovasi menciptakan produk-produk yang berteknologi tinggi, diantaranya menciptakan printer dengan mesin yang canggih. Dengan memeiliki berbagai keunggulan printer canon PIXMA iP2770 diantaranya dilengkapi dengan teknologi FINE (Full-Fotolitografi Inkjet Nozzle Engineering) arsitektur, Chromal life100+, dan sistem tinta hibrida. Ragam Teknologi canggih inilah yang kemudian mengasosiasikan printer inkjet canon identik dengan kualitas tinggi dan efisien.
    Dalam situasi persaingan yang semakin ketat tersebut,telah banyak perusahaan menempatkan orientasi pada kepuasan pelanggan sebagai tujuan utama, hal ini tercermin dengan semakin banyaknya perusahaan yang menyatakan komitmennya pada kepuasan pelanggan dalam pernyataan misinya, iklan maupun tujuan utamanya. Hal ini dikarenakan perusahaan menyadar bahwa pemenuhan keinginan kebutuhan konsumen merupakan syarat ekonomi dan sosial bagi kelangsungan hidup perusahaan.
    TOMART adalah salah satu Perusahaan yang bergerak dalam bidang usaha penjualan perlengkapan komputer dan printer. Dengan berkembangnya keinginan dan kebutuhan akan adanya Printer yang Ragam teknologi canggih dan paling utama adalah kinerja yang sangat baik untuk berbagai aplikasi . Maka perusahaan Tomart berupaya meningkatkan kegiatan pemasaran dan profesonalisme pimpinan maupun karyawan dalam bekerjasama untuk mencapi tujuan yang maksimal. Dimana salah satu faktor yang terpenting dalam memasarkan produk adalah perusahaan harus mampu memberikan yang terbaik dengan menawarkan produk yang berkualitas dan dapat memenuhi harapan konsumen.

    Bentuk-bentuk pelayanan itu sendiri antara lain berupa, Model, harga, service, dan Nilai Ekonomis. Selanjutnya titik tolak untuk memahami perilaku pembeli adalah denagan mengetahui rangsangan pemasaran dan lingkungan yang memasuki kesadaran pembeli sehingga munculnya kepuasan untuk membeli.

    Adapun beberapa rangsangan yang mempengaruhi konsumen dalm melakukan keputusan pembeli adalah :
    • Produk : Konsumen selalu mengutamakan kualitas dalam memilih produk yang akan dipilihnya.

    • Harga : Dalam hal ini biasanya konsumen akan menilai apakah dengan mempertukarkan nilai dari produk itu maka, mereka akan mendapatkan sesuatu yang lebih baik bila menggunakan produk diharapkan mampu bersaing dengan harga produk lainnya.

    • Saluran Pemasaran : Saluran pemasaran ini meliputi kemudahan-kemudahan dalam mendapatkan produk dan garansi produk sehingga dapat mengefisienkan waktu dan tenaga mereka.

    • Promosi : Setiap perusahaan berharap dengan memuat informasi yang jelas dan ringkas tentang keunggulan produk-prduk yang akan ditawarkannya dapat mempengaruhi pikiran konsumen dan mampu menggiring mereka untuk mengambil keputusan dalam membeli produk yang ditawarkan tersebut.
    Disamping rangsangan yang berkaitan dengan sebuah produk tersebut berpengaruhi pula rangsangan yang berasal dari faktor Ekonomi, teknologi, politik dan buday

    Berikut ini tabel Volume penjualan Printer canon dan Pinter Epson. Pada perusahaan Tomart pada tahun 2009 – 2010 sebagai berikut :
    Tabel
    Volume Penjualan Printer Pada Perusahaan Tomart

    Tahun Type Printer
    Printer Canon PIXMA iP2770 Printer EPSON
    2009 655 421
    2010 715 528

    Dari tabel diatas kecenderungan konsumen untuk Printer Canon dibandingkan dengan Printer Epson. ini dilihat dari peningkatan penjualan Printer yang dipasarkan oleh perusahaan Tomart. Pada tahun 2009 Printer Canon menjual sebanyak 655 unit, 421 unit untuk Printer Canon. Pada tahun 20010 penjualan Printer Canon mencapai 715 unit, Epson pada tahun yang sama 528 unit.
    Dari Tabel dan penjelasan diatas bahwa penjualan printer dari tahun ke tahun mengalami peningkatan penjulan.

    Tahapan proses pengambilan keputusan konsumen ini juga di pengaruhi oleh informasi yang diterima oleh konsumen dari perusahaan tersebut dan pihak yang terlebih dahulu menggunakan Printer Canon. Langkah berikutnya meyikapi informasi yang telah ditarimanya. Diman konsumen akan bersikap meyakinkan informasi yang telah diperoleh atau tidak,dengan memilih jenis tertentu untuk dibeli. Dalam hal ini terhadap jenis produk tertentu kan mempengaruhi apakah konsumen akan membeli atau tidak. Sikap positif terhadap jenis Printer Canon akan memungkinkan konsumen untuk melakukan pembelian terhadap Printer Canon, sebaiknya sikap negatif akan menghalangi konsumen untuk melakukan pembelian.

    1.2 Rumusan Masalah
    Perusahaan Tomart merupakan perusahaan yang bergerak dibidang penjualan komputer dan printer. Berdasarkan data yang ada pada perusahaan TOMART tiga bulan terakhir ini memperlihatkan perkembangan penjualan Printer canon dan Printer Epson.

    Hal ini menunjukan bahwa minat masyarakat sekarang lebih besar terhadap Printer Canon.
    Tugas utama perusahaan adalah memahami apa yang terjadi dalam kesadaran pembeli, mulai dari adanya rangsangan dari dalam atau faktor-faktor yang mempengaruhi konsumen hingga munculnya keputusan pembeli. Hal ini dapat juga mempelancar serta mempengaruhi promosi yang dilakukan oleh perusahaan TOMART terhadap penjualan Printer Canon.
    Sikap yang dimiliki konsumen sekarang ini merupakan hasil dari pengalaman terdahulu, karena sikap terbentuk sebagai hasil dari kontak langsung maupun tidak langsung dengan objek sikap. Namun konsumen akan memiliki keyakinan yang jauh lebih kuat mengenai sikap mereka terhadap produk bila didasarkan pada iklan saja. Misalnya sebelum membeli Printer Canon, seseorang mendapatkan informasi bahwa Printer Canon mempunyai keunggulan dari segi bahan bakar yang irit, kepraktisan dalam berkendara, perawatan yang tidak sulit. Maka dari itulah orang tersebut akan terpengaruhi dengan semua keunggulannya dan memutuskan untuk membeli Printer Canon.
    Oleh karena itu perusahaan harus jeli memahami,mengenali serangkaian kebutuhan dan kegiatan konsumen dari suatu kelompok, salah satu caranya dengan memahami sikap konsumen terhadap produk tertentu.
    Berdasarkan dari uraian diatas,maka yang terjadi masalah pokok dalam penelitian ini adalah ” bagaimana siakp konsumen pada perusahaan TOMART terhadap PRINTER CANON ”.

    1.3 Tujuan dan Manfaat Penelitian

    Tujuan Penelitian
    Adapun tujuan penelitian ini adalah berikut:
    1. Untuk mengetahiu sikap konsumen terhadap produk Printer canon di jambi
    2. Untuk menganalisis sikap konsumen terhadap produk Printer Canon di jambi.

    1.4 Manfaat Penelitian
    Bafi perusahaan hasil penelitian ini dapat digunakan sebagai bahan informasi dan masukan bagi pihak perusahaan untuk mengetahui sikap konsumen dalam membeli produk yang ditawarkan sehinggga pihak perusahaan dapat meningkatkan strategi dalam rangka memenuhi harapan konsumen.
    bagi penulis, selain sebagai syarat menyelesaikan pendidikan,juga dapat menambah ilmu pengetahuan bidang ilmu manajemen pemasaran.

    1.5 Ruang Lingkup Penelitian
    Agar penelitian ini lebih terarah dan sesuai dengan judul yang dibuat, maka pembahasannya dibatasi hanya pada hal-hal yang erat hubungannya dengan objek penelitian, dengan ruang lingkup sebagai berikut :
    1. Bidang yang diteliti Ilmu manajemen pemasaran,khususnya dibidang sikap konsumen
    2. Produk yang diteliti
    Printer canon.
    3. objek yang diteliti Konsumen di perusahaan Tomart

    Dalam variabel sikap hendaknya ditunjukkan variabel dependen dan independen. Tambahkan daftar pustaka, pustaka online lebih baik.

    Hanter, judulmu ok. Tapi penjelasanmasih perlu diperbaiki. Manfaat penelitian ada dua akademis dan praktis. Tambahkan daftar pustaka ke dalam proposal anda ini.

    Komentar oleh joni hanter | Januari 6, 2012 | Balas

  89. 1.1 Latar Belakang Masalah
    Pemasaran merupakan salah satu aspek penting dalam menunjang keberhasilan bagi suatu perusahaan, dengan adanya persaingan yang semakin ketat akan mempengaruhi kelangsungan hidup perusahaan. Dalam kondisi yang demikian perusahaan akan dihadapkan pada tantangan perilaku, daya beli, selera dan sosial budaya. Pengelolaan perusahaan dituntut untuk selalu tanggap dan jeli dalam melihat situasi lingkungan perusahaan yaitu pasar tempat perusahan melakukan aktivitas pemasaran dan perubahan-perubahan yang terjadi di lingkungan perusahaan.Upaya untuk mencapai tujuan pemasaran produk dengan demikian perusahaan perlu memahami dan mempelajari bagaimana perilaku keputusan pembelian konsumen dalam usaha memenuhi kebutuhan dan keinginan konsumen. Karena bagi konsumen, pasar menyediakan berbagai pilihan, produk serta merek beraneka ragam dan konsumen bebas memilih produk yang akan dibelinya.Beberapa konsumen telepon genggam di Indonesia sekarang sudah tak terhitung lagi jumlah nya.Salah satu merk ternama yang paling di minati konsumen di Indonesia adalah Blackberry (smart phone) dan Nokia .
    Pada saat sekarang potensi pemasaran produk Blackberry di Indonesia sangat menjanjikan. Pertama dilihat dari jumlah penduduknya sebanyak 237.556.363 pada tahun 2010 (menurut sensus penduduk Indonesia). Sekitar 10% saja bisa dirangkul menjadi pelanggan setia itu berarti 2.375.563 orang. suatu jumlah yang fantastik dan itu terdata 2 tahun lalu,mungkin pada saat sekarang jumlah konsumen setia Blackberry meningkat seiring dengan makin banyak nya peluncuran produk-produk baru yang di keluarkan RIM. Merebaknya penggunaan layanan BlackBerry tentunya juga tidak terlepas dari berbagai upaya yang dilakukan oleh tiga operator yaitu Indosat, Telkomsel dan XL. Tidak hanya dari sisi fungsionalnya saja, tetapi juga upaya menjadikan penggunaan BlackBerry sebagai bagian dari gaya hidup. Pemakaian BlackBerry sudah tidak mengenal batas usia, pekerjaan, ataupun atributatribut status sosial lainnya. Kemampuan operator menyediakan inovasi layanan BlackBerry dengan basis tarif yang kian terjangkau.
    Seiring dengan berkembangnya teknologi, masyarakat Indonesia khususnya yang hidup di wilayah perkotaan mulai mengalami perubahan gaya hidup. Bagi mereka, ponsel tidak hanya digunakan sebagai alat telepon atau sms saja, tetapi mereka juga sudah memperhatikan fitur-fitur lainnya yang mulai terdapat pada semua jenis dan tipe handphone yang beredar di pasaran. Selain itu, merek handphone pun sudah menjadi pilihan gaya hidup mereka, merek yang lebih terkenal di kalangan masyarakat Indonesia maka akan lebih diminati daripada merek lainnya yang belum terkenal atau bahkan tidak terkenal sama sekali. Salah satunya adalah handphone merek Nokia yang sudah dikenal di pasaran oleh masyarakat Indonesia pada umumnya. Nokia adalah Brand ternama untuk gadget handphone di Indonesia. Nokia pertama kali diciptakan pertama kali di Finlandia, dan mulai beroperasi pada awal tahun 1980. Sejak berdiri Nokia telah berhasil memimpin di pasaran, dan bisnis Nokia telah berkembang di semua negara untuk memenuhi kebutuhan pelanggan dan perkembangan industri telekomunikasi di negara-negara tersebut termasuk Indonesia. Nokia sejak dahulu telah menjadi penguasa pasar ponsel dunia, akan tetapi makin banyak merek-merek pesaing bermunculan yang siap menggeser pangsa pasar Nokia sebagai market leader sementara. Buktinya, Nokia mencatat hasil kuartalan terburuk dalam satu dekade ini.
    Di tahun 2009, Nokia mengalami penurunan laba operasional sebesar 96%. Kuartal pertama, Nokia menghasilkan laba operasional hanya sebesar 55 juta Euro, sedangkan tahun sebelumnya Nokia berhasil mencetak laba sebesar 1,5 miliar Euro. Penurunan perolehan laba Nokia sangat turun tajam, bila dibandingkan dengan tahun sebelumnya. Press release yang diterbitkan Nokia mengungkapkan bahwa volume penjualan Nokia semakin menurun, dari tahun ke tahun dan beruntut. Pada kuartal ke2 nya Nokia hanya berhasil memperoleh laba bersih 380 juta Euro dari penjualan senilai 13,5 miliar Euro. Ini jauh menurun dibandingkan laba bersih pada periode yang sama tahun lalu, yakni 1,1 miliar Euro dari penjualan 13,15 miliar Euro. Hal tersebut juga tampak pada segmen handphone lainnya seperti ponsel pintar alias smartphone yang sedang menjadi tren saat ini.
    Oleh karena itu pemasar perlu memahami bagaimana perilaku konsumen dalam usaha memuaskan kebutuhan dan keinginannya. Perilaku konsumen merupakan suatu proses pengambilan keputusan yang mensyaratkan aktivitas individu untuk mengevaluasi, mencari, menggunakan barang dan jasa sehingga memuaskan kebutuhan. Promosi merupakan cara menjual produk melalui tenaga penjualan yang terampil dalam menyampaikan pesan-pesan. Dimana tujuan utama promosi adalah menginformasikan, mempengaruhi dan membujuk pembeli untuk belanja, serta mengingatkan pelanggan sasaran tentang perusahaan. Informasi pada konsumen berupa informasi pasar mengenai keberadaan suatu produk, cara pemakaian produk, perubahan harga serta membangun citra perusahaan. Pada dasarnya pemasar produk dengan keterlibatan tinggi harus memahami keterlibatan yang tinggi dengan perilaku pengumpulan informasi dan evaluasi konsumen. Pemasar perlu mengembangkan strategi yang membantu pembeli mempelajari atributatribut produk dan tingkat kepentingan relatif mereka, serta yang menarik perhatian pada reputasi merek perusahaan dalam atribut-atribut yang lebih penting. Berdasarkan latar belakang tersebut, penulis mengadakan penelitian “Analisis promosi penjualan dan minat konsumen pada produk Blackberry dan Nokia di Indonesia”.

    1.2 Rumusan masalah
    Berdasarkan latar belakang masalah yang telah dikemukakan diatas dapat dirumuskan masalah sebagai berikut:
    1. Faktor apa saja yang mempengaruhi konsumen dalam pengambilan keputusan pembelian ponsel ?
    2. Apa pengaruh dari promosi terhadap keputusan pembelian produk ponsel ?
    3. Apakah minat konsumen ponsel dapat berubah ubah seiring berkembangnya jaman dan kebutuhan lifestyle konsumen ?

    1.3 Tujuan penelitian
    Sesuai dengan latar belakang dan perumusan masalah yang ditentukan maka tujuan penelitian yang hendak dicapai adalah:
    1. Untuk mengetahui dan menganalisis faktor-faktor yang dipertimbangkan konsumen dalam mengambil keputusan membeli ponsel BlackBerry atau Nokia.
    2. Peneliti diharapkan dapat menganalisa pengaruh promosi terhadap keputusan pembelian ponsel ?
    3. Peneliti diharapkan dapat mencari tau tentang minat pembelian ponsel mengikuti perkembangan jaman dan kebutuhan lifestyle?

    1.4 Manfaat Penelitian
    Adapun manfaat dari penelitian ini adalah sebagai berikut:
    1. Bagi perusahaan dan instansi-instansi yang terkait dengan produk BlackBerry dan Nokia, dapat menjadi pertimbangan perusahaan guna meningkatkan kualitas produk terhadap konsumen dan menjadi penilaian terhadap faktor yang dipertimbangkan konsumen dalam memutuskan membeli Handphone BlackBerry atau Nokia
    2. Bagi peneliti, menerapkan teori-teori yang pernah didapat dan yang dipelajari selama mengikuti perkuliahan yang berhubungan dengan masalah yang telah dikemukakan diatas sehingga dapat diharapkan ilmu tersebut dapat diterapkan dengan baik dan benar.
    3. Bagi Universitas, memberikan informasi sebagai bahan studi lebih lanjut bagi yang ingin mengadakan penelitian yang berkaitan dengan topik yang sama serta memberikan sumbangan bagi karya tulis ilmiah di perpustakaan

    Komentar oleh YANOV | Januari 6, 2012 | Balas

    • mohon komentar nya ya pak jo ..

      Komentar oleh YANOV | Januari 6, 2012 | Balas

  90. Yanov. Perbaiki uraian di atas dg menambahkan atribut produk BB sehingga itu yg dituliskan pada rumusan masalah. Atribut ini bisa menggunakan konsep pada Kotler. Selanjutnya perbaiki dg menambahkan daftar pustaka.

    Komentar oleh johannessimatupang | Januari 6, 2012 | Balas

  91. NAMA : YUDI ANDRIANSYAH PUTRA

    BAB I
    PENDAHULUAN

    1.1 Latar Belakang Masalah

    Perkembangan teknologi informasi dan globalisasi yang begitu pesat, berdampak semakin tingginya persaingan memperebutkan pangsa pasar pada dunia usaha saat ini. Perusahaan yang ingin berhasil dalam persaingan pada era millinium harus memiliki strategi perusahaan yang dapat memahami perilaku konsumen. Perusahaan yang baik adalah memahami betul siapa konsumennya dan bagaimana mereka berperilaku. Pemahaman mengenai siapa konsumennya akan menuntun para pengusaha kepada keberhasilan memenangkan persaingan dunia usaha yang telah melampaui batas negara. Dunia teknologi informasi memang selalu menarik untuk diamati, ini ditandai dengan perkembangan internet dan teknologi informasi seperti komputer yang begitu cepat dan canggih sehingga setiap orang tertarik untuk memiliki. Sekarang ini setiap orang tidak hanya memiliki suatu produk karena fungsinya saja, tetapi juga rasa bangga dan pengakuan yang didapatkan dari memiliki produk tersebut.Teknologi computer (PC Desktop dan Notebook ) merupakan salah bentuk produk yang inovasinya tiada henti yang dapat menarik perhatian konsumen untuk membeli. Dengan desain yang diimbangi dengan fitur-fitur/fasilitas yang disediakan disesuaikan dengan perkembangan kebutuhan konsumen merupakan daya tarik untuk mempengaruhi perilaku konsumen. Seperti yang dilakukan oleh perusahaan ACER yang memiliki keunggulan dalam haldesain dibandingkan dengan pesaing pesaingnya seperti HEWLET PACKARD, TOSHIBA, LENOVO,merek lain/Gabungan (NEC, SONY, APPLE, GATWAY ,dll).Persaingan yang sangat ketat dimana ACER meraih pangsa pasar komputer terbesar 30 % untuk pasar di Indonesia, kemudian
    Hewlet Packard (HP) dengan pangsa pasar 12 % dan merek lain seperti TOSHIBA, LENOVO, bersaing ketat rata-rata 10 persen sedangkan merek lain seperti NEC, APPLE, GATWAY, SONY,dan lain-lain masih jauh terlalu jauh bila dibandingkan dengan lain yang pangsa pasarnya sudah mencapai rata-ratadi atas 10 %.
    Semakin banyaknya pelaku usaha yang bergerak dalam bidang usaha yang sejenis yang beroperasi serta memproduksi dengan menawarkan berbagai macam produk/jasa yangditawarkan, membuat masyarakat sulit menentukan pilihan sesuai dengan kebutuhan mereka.Oleh sebab itu, para pelaku usaha berlomba untuk meningkatkan mutu produksi sehingga dapat menarik para konsumen untuk membeli hasil produk yang ditawarkan.Di lain pihak seperti halnya yang sudah disebutkan, apabila sebuah produk/jasa melebihi harapan konsumen, konsumen akan merasa puas dan akan melakukan pembelian ulang. Hal ini merupakan perilaku konsumen dimana suatu tindakan nyata bagi konsumen yang dipengaruhi oleh faktor-faktor kejiwaan dan faktor luar lainnya yang dapat mengarahkan mereka untuk memilih dan mempergunakan barang/jasa yang diinginkannya.Perilaku konsumen dapat dirumuskan sebagai perilaku yang ditunjukkan oleh orang-orang, dalam hal merencanakan, mempertimbangkan, membeli dan menggunakan barang-barang atau jasa-jasa yang ditawarkan oleh setiap pelaku usaha. Dengan demikian dapat disimpulkan perilaku konsumen terdiri dari aktifitas-aktifitas yang melibatkan orang-orang sewaktu sedang menyeleksi, mempertimbangkan, membeli dan menggunakan produk-produk dan jasa-jasa,sedemikian rupa sehingga hal tersebut dapat memberikan kepuasan bagi mereka sehingga terpenuhi kebutuhan-kebutuhan dan keinginan-keinginan mereka.Minat beli setiap seseorang dapat ditingkatkan dengan memperhatikan beberapa faktor,antara lain faktor psikis yang merupakan faktor pendorong yang berasal dari dalam diri konsumen itu sendiri yaitu motivasi, persepsi, pengetahuan, keyakinan dan sikap, selain itu faktor sosial yang merupakan proses dimana perilaku seseorang di pengaruhi oleh keluarga, status sosial, dan kelompok acuan, kemudian pemberdayaan bauran pemasaran yang terdiri dari produk, harga, promosi dan juga distribusi. Perilaku konsumen pasca pembelian sangat penting bagi suatu perusahaan. Dengan demikian perilaku konsumen dapat mempengaruhi orang atau pihak lain dengan ucapan-ucapan mereka tentang suatu produk yang dihasilkan oleh suatu perusahaan.Bagi semua perusahaan, baik yang menjual produk maupun jasa, perilaku konsumen pasca pembelian, akan menentukan minat konsumen apakah mereka akan membeli lagi produk/jasa perusahaan yang ditawarkan tersebut. Ada kemungkinan konsumen tidak akan membeli produk/jasa perusahaan yang ditawarkan lagi setelah mereka merasakan ketidaksesuaian kualitas produk/jasa yang didapatkan dengan keinginan atau apa yang digambarkan sebelumnya.Di sini penulis membahas tentang produk komputer yaitu Personal Computer Desktop dan Notebook walau saat ini komputer bukan lagi barang yang langka, tapi masih saja banyak orang yang gamang dan bingung menentukan komputer yang ingin mereka miliki, baik itu Branded,Rakitan maupun Bekas.Untuk bisa mendapatkan komputer sesuai dengan yang kita butuhkan diperlukan perencanaan yang matang maka surveylah terlebih dahulu.
    Dari latar belakang yang dikemukakan maka penulis mencoba untuk melakukan penelitian dengan judul
    “Analisis Faktor-Faktor yang Mempengaruhi Perilaku Konsumen Dalam Membeli Komputer di JAMBI”

    2. Rumusan Masalah

    1.Apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara parsial terhadap perilaku konsumen dalam pembelian komputer ?
    2.Apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara serempak terhadap perilaku konsumen dalam pembelian komputer ?
    3.Diantara faktor-faktor tersebut di atas, faktor mana yang paling dominan mempengaruhi konsumen dalam melakukan pembelian komputer.?

    3.Tujuan Penelitian

    1.Untuk mengkaji apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara parsial terhadap perilaku konsumen dalam membeli komputer.
    2Untuk mengkaji apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara serempak terhadap perilaku konsumen dalam membeli komputer
    3.Untuk mengetahui faktor mana yang paling dominan mempengaruhi konsumen dalam melakukan pembelian komputer.

    4.Manfaat Penelitian

    1.Sebagai sarana dan media untuk mengembangkan ilmu pengetahuan dan sebagai bahan literature untuk menambah wacana baru bagi dunia akademis.
    2.Sebagai sarana untuk memperoleh informasi yang tepat dan akurat dalammempengaruhi dan mengetahui pengambilan keputusan oleh konsumen yang dilihat dari perilaku konsumen.
    3.Sebagai bahan masukan bagi perusahaan dalam menentukan produk yang benar-benar sesuai dengan kebutuhan, keinginan dan selera konsumen..
    4.Untuk memperkaya khasanah penelitian yang ada serta dapat digunakan sebagai perbandingan penelitian berikutnya.

    Komentar oleh YUDI ANDRIANSYAH PUTRA | Januari 7, 2012 | Balas

  92. TUGAS INDIVIDU
    NAMA : PRISKILA MUTIARA SEMBIRING
    NIM : C1B009067
    MGT B 09

    JUDUL : MENGANALISA FAKTOR-FAKTOR YANG MEMPENGARUHI PERILAKU KONSUMEN DALAM MEMBELI HELM MERK HIU

    Hindari duplikasi dari yg sudah ada. Simak lebih dalam judul seperti ini telah ada, cuma merek helemnya diganti.

    Komentar oleh PRISKILA MUTIARA SEMBIRING | Januari 8, 2012 | Balas

  93. TUGAS I (INDIVIDU)
    NAMA : ALEX AGUS SAPUTRA
    NIM : C1B009029
    MGT A’09

    judul :
    “PENGARUH KUALITAS PELAYANAN TERHADAP LOYALITAS PELANGGAN JASA BUS PO. FAMILY RAYA CERIA”

    Judul mu ok saja, tapi hindari dari duplikasi. Silahkan dipertimbangkan, segera tulis proposal tentatif.

    Komentar oleh alex agus saputra | Januari 8, 2012 | Balas

  94. TUGAS I (INDIVIDU)
    NAMA : ALEX AGUS SAPUTRA
    NIM : C1B009029
    MGT A’09

    Judul Proposal Skripsi
    :”PENGARUH KUALITAS PELAYANAN TERHADAP LOYALITAS PELANGGAN JASA BUS PO. FAMILY RAYA CERIA”

    Komentar oleh alex agus saputra | Januari 8, 2012 | Balas

  95. TUGAS I INDIVIDU
    NAMA : GIDEON DWI PRASETYO
    NIM : C1B009144

    Judul : ” Analisis Pengaruh Kualitas Pelayanan Rumah Sakit Ibu dan Anak Terhadap Ibu – ibu hamil (RSB Anisa Kota Jambi)”

    Gideon kamu pilih satu judul saja, silahkan buat proposal tentatif.

    Komentar oleh gideon dwi prasetyo | Januari 8, 2012 | Balas

    • BAB I
      PENDAHULUAN
      1.1. Latar Belakang
      Seiring dengan berkembangnya ilmu pengetahuan dan teknlogi dewasa ini, maka sudah dapat dipastikan bahwa tingkat peradaban suatu bangsa akan semakin meningkat. Dengan semakin kompleksnya kebutuhan yang harus dipenuhi, masyarakat tidak bias mengesampingkan kesehatannya begitu saja. Kesehatan merupakan faktor penting untuk menjalankan aktifitas sehari – hari. Masyarakat cenderung melakukan apa saja untuk menjaga kesehatan badannya seperti berolah raga, makan makanan yang sehat, rutin memeriksakan kesehatannya, istirahat yang cukup dan lain – lain.
      Kesehatan merupakan hal penting bagi manusia. Oleh karenanya kesehatan harus senantiasa dijaga. Kesadaran masyarakat yang semakin tinggi terhadap pentingnya kesehatan merupakan salah satu alasan bahwa kebutuhan akan prasarana kesehatan juga semakin meningkat, selain itu pula masyarakat akan semakin pandai untuk memilih mana yang terbaik dan sesuai dengan apa yang mereka inginkan dan butuhkan. Tumbuh suburnya tempat – tempat pelayanan kesehatan atau klinik serta rumah sakit diberbagai tempat merupakan salah satu bukti bahwa produsen telah merespon keinginan dan kebutuhan masyarakat.
      Rumah sakit merupakan bagian dari integral dari keseluruhan sistem pelayanan kesehatan yang dikembangkan melalui rencana pembangunan kesehatan. Rumah sakit merupakan tempat penampungan orang yang memiliki gangguan kesehatan yang memerlukan rawat inap, rawat jalan maupun kontrol kesehatan. Rumah sakit juga tempat konsentrasi berbagai ahli kesehatan, kedokteran, pasien yang sakit. Rumah sakit mengalami pertumbuhan yang begitu pesat sejak badan hukum perseroan terbatas diizinkan untuk mendirikan rumah sakit. Perubahan orientasi ini menyebabkan terjadinya persaingan antara rumah sakit dalam meningkatkan jumlah pemakai jasa rumah sakit. Persaingan ini memaksa pihak manajemen harus membuat suatu konsep rencana pemasaran yang berorientasi kepada konsumen bagi rumah sakit yang dikelolanya sehingga rumah sakit tersebut akan mempunyai suatu keunggulan yang dapat dipergunakan untuk menghadapi persaingan.
      Taraf kehidupan yang membaik membuat masyarakat menjadi krisis terhadap jasa atau layanan kesehatan, mereka mulai menuntut penyediaan layanan kesehatan yang berkualitas. Bagi kalangan menengah keatas, mereka tidak segan – segan pergi keluar negeri demi memperoleh kesehatan yang baik, meskipun kemampuan tenaga medis dalam negeri tidak kalah dengan tenaga medis asing. Fakta ini merugikan pemerintah.
      Menjadi organisasi yang fokus pada konsumen adalah pilihan strategis bagi industri dan dunia usaha agar mampu bertahan di tengah situasi lingkungan ekonomi yang memperlihatkan kecenderungan fluktuasi yang curam, perubahan demi perubahan, persaingan tinggi dan semakin canggihnya kualitas hidup salah satu cara adalah dengan menciptakan kepuasan pelanggan di Rumah Sakit Bersalin Annisa Jambi melalui

      peningkatan kualitas, karena pelanggan adalah fokus utama ketika kita mengungkapkan tentang kepuasan dan kualitas jasa (Lupiyoadi,2006). Pasien yang merasakan kepuasan pelayanan akan menguntungkan pihak rumah sakit yaitu dapat menambah kesetiaan pasien terhadap rumah sakit, sebaliknya ketidak puasan yang dialami pasien dapat merusak citra rumah sakit dimata publik khususnya bagi calon pemakai jasa (Wahyudin,2005).
      Dalam operasionalnya rumah sakit memprioritaskan kepuasan pasien dalam upaya memenuhi tingkat kepentingan dan harapan pasien. Apabila dalam operasionalnya rumah sakit tidak mampu memenuhi harapan pasien, maka yang terjadi adalah penurunan atas kepuasan pasien kepada pihak rumah sakit yang berdampak pada munculnya komplain dari pasien atau bahkan penurunan jumlah pasien.Rumah Sakit Bersalin Annisa Jambi pelayanan yang diberikan oleh pihak rumah sakit sudah dalam kategori memuaskan.
      Berdasarkan hasil penelitian yang dilakukan oleh Poerwanto dan Tunayah (2006:41) menyatakan bahwa pelayanan yang tersedia di rumah sakit 5 mempunyai pengaruh terhadap kepuasan pasien rumah sakit. Dalam memberikan pelayanan jasa yang baik kepada pasien perlu diperhatikan kriteria penentu kualitas jasa pelayanan. Penawaran jasa kepada pasien harus didasarkan pada kepentingan pasien dan kinerja rumah sakit harus memperhatikan setiap hal yang dianggap penting oleh pasien. Rumah sakit harus memperhatikan prosedur penerimaan pasien yang cepat dan tepat, bersikap ramah kepada pasien, tanggap menjelaskan keluhan pasien sekaligus cepat memberikan pemeriksaan, pengobatan dan perawatan sehingga pasien merasa diperhatikan.
      Tinggi rendahnya mutu pelayanan kesehatan yang disajikan dipengaruhi oleh faktor – faktor sumber daya rumah sakit dan interaksi kegiatan yang di selenggarakan melalui proses atau prosedur tentu dalam memanfaatkan sumber daya yang ada.
      Fakta dan uraian tersebut diatas selanjutnya memotivasi penelitian tentang pengaruh kualitas layanan terhadap kepuasan pasien pada Rumah Bersalin Annisa Jambi. Hal ini penting untuk memperkirakan keinginan dan harapan-harapan pelanggan agar pelayanan yang disediakan bisa memberikan kepuasan lebih optimal lagi.

      1.2.Perumusan Masalah
      Sesuai dengan latar belakang dan perumusan masalah yang dikemukakan tersebut maka tujuan penelitian ini adalah :
      Apakah kualitas layanan kesehatan mempengaruhi kepuasan pasien terhadap Rumah Sakit Bersalin Annisa Jambi?

      1.3. Tujuan Penelitian
      Sesuai dengan latar belakang dan perumusan masalah yang dikemukakan tersebut maka tujuan penelitian ini adalah : Untuk menganalisis pengaruh kualitas layanan jasa mempengaruhi kepuasan pasien Rumah Sakit Bersalin Annisa Jambi.

      1.4.Manfaat penelitian
      Manfaat dari diadakannya penelitian ini adalah :
      1. Bagi Rumah Sakit Bersalin Annisa Jambi penelitian ini dapat dijadikan bahan masukan dalam menentukan strategi pemberian layanan pada pasien sehingga mereka mendapatkan kepuasan optimal.
      2. Bagi ilmu pengetahuan hasil penelitian ini dapat digunakan untuk menambah referensi bagi rekan-rekan mahasiswa yang melakukan penelitian dengan topik yang sama

      BAB II
      2.1.Lokasi Penelitian

      2.2.Populasi
      1.Populasi Penelitian
      Populasi dalam penlitian ini adalah seluruh pasien atau ibu ibu hamil yang ingin melakukan proses persalinan.

      2.3.Jenis dan Sumber Data
      1.Jenis Data
      Jenis data dalam penelitian ini berupa :
      a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, skema, dan gambar, sepertu literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
      b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).
      2.Sumber Data
      Sumber data dalam penelitian ini berupa :
      a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.
      b.Data Sekunder, yaitu data yng diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari situasi-situasi internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.

      2.4.Teknik Pengumpulan Data
      Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
      a.Interview, yaitu suatu metode pengumpulan data dengan cara mengadakan wawancara langsung dengan responden dengan bantuan daftar pertanyaan untuk mengumpulkan data primer.
      b.Kuesioner, yaitu suatu teknik pengumpulan data yang dilakukan dengan cara memberikan seperangkat pertanyaan atau pertanyaan tertulis pada responden untuk menjawab.

      Komentar oleh Gideon Dwi Prasetyo | Januari 24, 2012 | Balas

  96. TUGAS I INDIVIDU
    NAMA : GIDEON DWI PRASETYO
    NIM : C1B009144
    MGT G’09

    Judul : ” Analisis Pengaruh Kualitas Pelayanan Rumah Sakit Ibu dan Anak Terhadap Ibu – ibu hamil (RSB Anisa Kota Jambi)”

    Komentar oleh gideon dwi prasetyo | Januari 8, 2012 | Balas

  97. Nama : Marhamah
    Nim : ERC1B009061
    Kls : ekstensi siang
    Salam pak jo :)
    Maaf pak Saya mau tanya,yg di maksud proposal tentatif itu apa pak?? S
    saya harus membuat bab brpa saja pak?? Bab 1 saja kah atau smuanya pak,,tolong penjelasanny ya pak.. Dan apakah saya boleh mengajukan judul yg bru pak?? Trima kasih :)

    Pertanda tidak masuk kelas. Tenttif meliputi: Latar belakang, rumusan masalah, tujuan, hingga sampai penentuan sampel dan populasi.

    Komentar oleh Marhamah | Januari 8, 2012 | Balas

  98. TUGAS INDIVIDU 1
    NAMA :INDRA PRAMONO
    NIM : EC1B010002
    KELAS : SORE EKSTENSI MANAJEMEN

    judul : ”strategi meningkatkan kualitas penjualan mobil mitshubishi dikota jambi (dealer PT. Kerinci Permata kota jambi)”

    Judul ini terlalu luas, ambil misalnya untuk pemasaran dg organisasi. Pembeli organisasi maksudnya, bagaimana strategi mereka memasuki pasar organisasi. Prinsipnya dipersempit. Proposal tentatif ditunggu.

    Komentar oleh indra riky ski | Januari 8, 2012 | Balas

  99. TUGAS I (INDIVIDU)
    NAMA : ALEX AGUS SAPUTRA
    NIM : C1B009029
    MGT A’09

    judul proposal skripsi
    “Pengaruh Kualitas Pelayanan Terhadap Loyalitas Pelanggan Jasa Bus Po.Family Raya Ceria”

    BAB 1
    PENDAHULUAN

    1.1 Latar Belakang
    Sektor perhubungan memegang peranan penting dalam kehidupan sehari-hari dan merupakan sarana prasarana yang sangat mendukung keberhasilan pembangunan daerah maupun nasional. Dengan banyaknya perusahaan yang bergerak dalam usaha transportasi yang beroprasi, maka akan membawa dampak persaingan yang ketat diantara perusahaan dalam perebutan konsumen. Dalam situasi yang semakin ketat telah banyak perusahaan yang sengaja berorientasi pada kepuasan pelanggan sebagi tujuan utama.
    Menurut Kotler (1995) manajemen pemasaran adalah proses perencanaan dan pelaksanaan konsepsi, penentuan harga, promosi, dan distribusi barang-barang dan jasa untuk menciptakan pertukaran yang memuaskan. Pemasaran mempunyai empat variabel yang di sebut dengan marketing mix yaitu produk, harga, promosi dan distribusi. Pada jasa transportasi perlu adanya elemen tambahan dalam pemasaran yang di kenal dengan istilah 3P yaitu people (orang), physical envirotment (lingkungan fisik), dan proces (proses). Produk tersebut harus sesuai dengan keinginan konsumen, harga yang terjangkau. Disamping keempat variable marketing mix tersebut perusahaan harus memberikan berbagai bentuk pelayanan atau servis yang berkualitas yang mampu memberikan kepuasan kepada pengguna jasa. Pelayanan yang unggul sebagai alat untuk meraih keberuntungan dalam persaingan dengan perusahaan lain. Pelayanan yang baik dapat menumbuhkan kepuasan pelanggan yang pada akhirnya dapat memberikan manfaat banyak bagi perusahaan.
    Po.Family Raya Ceria merupakan salah satu perusahaan yang memberikan jasa transportasi yang cukup terkenal dan sangat bersaing dengan perusahaan sejenis. Dimana perusahaan Family Raya sudah cukup lama beroperasi dalam memberikan pelayanan jasa transportasi terutama pada trayek Bangko – Jambi, Jambi – Bangko.
    Rata – rata bus yang berangkat setiap dua jam sekali, mulai dari jam 08.00-22.00 dari Po. Family Raya Ceria.
    Adapun perkembangan jumlah penumpang atau penjualan tiket pada Po.Family Raya Ceria dari tahun ke tahun terus meningkat. Hal ini disebabkan oleh pelayanan Po.Family Raya Ceria yang memuaskan.
    Pengguna jasa yang merasa puas dalam pelayanan yang diberikan akan bersikap loyal terhadap perusahaan yang di anggap mampu memenuhi kebutuhan mereka akan merasakan kepuasan. Pada dasarnya pelanggan yang merasa puas merupakan alat promosi yang paling baik bagi perusahaan yang bersangkutan (Tjiptono: 1998 : 21). Dan pada dasarnya kepuasan dan ketidakpuasan pelanggan atas produk akan berpengaruh pada pola prilaku selanjutnya. Ini terjadi setelah terjadi suatu pembelian (kotler dalam Rambat, 2001:159).
    Apabila pelanggan merasa puas maka ia akan membeli kembali produk atau jasa yang sama dan merekomendasikan kepada orang lain untuk membeli produk atau jasa tersebut. Loyalitas merupakan salah satu implikasi keputusan seorang konsumen terhadap pelayanan jasa yang diberikan. Secara langsung maupun tidak langsung akan memberikan profit baik bagi perusahaan dan dapat mempengaruhi kelangsungan hidup perusahaan jangka panjang.
    Berdasarkan hal diatas maka penulis tertarik untuk melakukan penelitian lebih jauh lagi yang akan di terapkan dalam bentuk skripsi dengan judul “Pengaruh Kualitas Pelayanan Terhadap Loyalitas Pelanggan Jasa Bus Po.Family Raya Ceria”

    1.2 Rumusan Masalah
    Po.Family Raya Ceria adalah perusahaan yang bergerak di bidang jasa yang beorientasi kepada kepuasan pelanggan, dan berusaha memberikan pelayanan yang baik pada pelanggannya. Pelanggan yang puas dapat memberikan dampak yang positif bagi perusahaan jasa Po.Family Raya Ceria itu sendiri. Ini disebabkan munculnya persepsi pelanggan yang puas terhadap pelayanan yang di berikan akan mendorong pelanggan tersebut untuk merekomendasikan kepada orang lain, mengenai apa yang mereka rasakan terhadap kualitas pelayanan yang diberikan. Ini merupakan suatu promosi dari mulut kemulut yang baik dalam merebut para pelanggan lain.
    Untuk menciptakan kepuasan pelanggan dan kelangsungan Po.Family Raya Ceria, perusahaann harus memberikan pelayanan yang dapat memberikan kepuasan pelanggan, oleh karena itu perusahaan harus mengetahui tingkat kepuasan dengan pelayanan yang di berikan. Loyalitas merupakan bentuk nyata dari pelanggan yang puas akan apa yang diharapkan mereka dan dapat memberikan keuntungan bagi Po.Family Raya Ceria dalam mempertahankan pelanggan.
    Dari uraian diatas dapat di rumuskan dalam penelitian ini adalah “Bagaimana Pengaruh Kualitas Pelayanan Terhadap Loyalitas Pelanggan Jasa Bus Po.Family Raya Ceria”.

    1.3 Tujuan dan Manfaat Penelitian
    1.3.1 Tujuan Penelitian
    Adapun tujuan penelitian ini adalah sebagai berikut:
    1. Untuk mengetahui kualitas pelayanan akan jasa yang diberikan Po.Family Raya Ceria.
    2. Untuk mengetahui seberapa kuat pengaruh kualitas pelayanan terhadap loyalitas pelanggan jasa bus Po.Family Raya Ceria

    1.3.2 Manfaat Penelitian
    Adapun manfaat penelitian ini adalah sebagai berikut:
    1. Sebagai bahan masukan Po.Family Raya Ceria dalam meningkatkan kualitas pelayanan bagi pelanggan agar dapat memenuhi keinginan pelanggan.
    2. Sebagai informasi atau pengetahuan bagi peneliti yang melakukan studi dengan topik pengaruh kualitas pelayanan terhadap loyalitas pelanggan.
    3. Sebagai bahan kepustakaan khususnya pengaruh kualitas pelayanan terhadap loyalitas pelanggan.

    1.4 Ruang Lingkup Penelitian
    Agar pembahasan tidak terlepas dari permasalahan dalam penelitian ini sehingga apa yang menjadi tujuan dapat tercapai yaitu pengaruh kualitas pelayanan terhadap loyalitas pelanggan jasa bus Po.Family Raya Ceria yang terdiri dari lima dimensi yaitu tangible, reabilitry, ansuranse, responsivenes, dan empaty.

    Alex, sampel dan populasi belum tergambarkan. Daftar pustaka juga belum ada.

    Komentar oleh alex agus saputra | Januari 9, 2012 | Balas

    • BAB II
      TINJAUAN PUSTAKA

      2.1. Kepuasan Pelanggan

      2.1.1. Pengertian Kepuasan Pelanggan
      Dalam persaingan yang semakin ketat dewasa ini, para perusahaan dituntut untuk terlibat langsung dalam memenuhi kebutuhan pelanggannya yang yamg merupakan tujuan utamanya. Dalam hal ini, peranan indivu dalam service encounter sangat lah penting dan berpengaruh terhadap kepuasan yang dibentuk untuk dapat mengetahui tingkat kepuasan pelanggan secara lebih baik, maka perlu dipahami pula sebab-sebab kepuasan. Pelanggan juga tidak Cuma lebih banyak kecewa pada jasa dari pada barang, tetapi mereka juga jarang mengeluuh. Karena hal tersebut sering diyakini bahwa kunci utama memenangkan persaingan adalah memberikan nilai kepusan kepada pelanggan melalui penyampaian produk dan pelayanan yang berkualitas dengan harga bersaing.
      Sebenarnya konsep kepuasan pelanggan masih bersifat abstrak, pencapaian kepuasan pelanggan dapat merupakan proses yang sederhana, walaupun komplek dan rumit. Peran setiap individu dalam suatu perusahaan sangatlah penting dan berpengaruh terhadap kepuasan yang dibentuk. Untuk dapat mengetahui tingkat kepuasan pelanggan secara lebih baik, maka diperlukan pemahaman yang berkaitan dengan kepuasan pelanggan. Terciptanya kepuasan pelanggan bermanfaat dalam membina hubungan harmonis antara pelanggan dengan perusahaan, serta membentuk suatu rekomendasi yang menguntungkan bagi perusahaan.
      Kotler (1997:36) memberikan arti dari kepuasan konsumen yaitu tingkat perasaan seseorang setelah membandingkan performansi (atau hasil) yang ia rasakan dibandingkan dengan harapannya. Jadi tingkat kepuasan merupakan fungsi dari perbedaan antara kinerja yang dirasakan dengan harapannya. Apabila kinerja dibawah harapan, maka konsumen akan kecewa. Bila kinerja sesuai dengan harapan, konsumen akan puas. Sedangkan bila kinerja melebihi harapan, konsumen akan sangat puas. Harapan konsumen dapat dibentuk oleh pengalaman masa lampau, komentar dari kerabatnya serta janji dan informasi pemasar dan saingannya. Konsumen yang puas akan setia lebih lama, kurang sensitif terhadap harga dan memberi komentar yang baik tentang perusahaan.
      Menurut Zeithml dan Berry dalam Tjiptono (2005:89) bahwa ada 5 (lima) dimensi yang digunakan untuk mengukur kualitas pelayanan, yaitu: Tangible, Reliability, Responsiveness, Assurance, Empathy.
      1. Bukti langsung (tangibles)
      Definisi bukti langsung dalam Rambat Lupiyoadi (2001:148) yaitu “kemampuan suatu perusahaan dalam menunjukkan eksistensi kepada pihak eksternal. Penampilan dan kemampuan sarana dan prasarana fisik perusahaan dan keadaan lingkungan sekitarnya adalah bukti nyata dari pelayanan yang diberikan oleh pemberi jasa, yang meliputi fasilitas fisik gedung, perlengkapan dan peralatan yang dipergunakan (teknologi), serta penampilan pegawainya”.
      Bukti langsung dalam Fandy Tjiptono (1996:70) adalah “bukti fisik dari jasa, bisa berupa fisik, peralatan yang dipergunakan, representasi fisik dari jasa”.
      Sedangkan Philip Kotler (1997:53) mengungkapkan bahwa bukti langsung adalah “fasilitas dan peralatan fisik serta penampilan karyawan yang professional”.
      2. Kehandalan (reliability)
      Kehandalan dalam Rambat Lupiyoadi (2001:148) adalah “kemampuan perusahaan untuk memberikan pelayanan sesuai yang dijanjikan secara akurat dan terpercaya. Kinerja harus sesuai dengan harapan pelanggan yang berarti ketepatan waktu, pelayanan yang sama, untuk semua pelanggan tanpa kesalahan, sikap yang simpatik, dan dengan akurasi yang tinggi”.
      3. Daya tanggap (responsiveness)
      Menurut Rambat Lupiyoadi (2001:148) daya tanggap adalah “suatu kemauan untuk membantu dan memberikan pelayanan yang cepat (responsif) dan tepat kepada pelanggan, dengan penyampaian informasi yang jelas. Membiarkan konsumen menunggu tanpa adanya suatu alasan yang jelas menyebabkan persepsi yang negatif dalam kualitas pelayanan”.
      Sedangkan menurut Fandy Tjiptono (1996:70) daya tanggap adalah “keinginan para staf untuk membantu para pelanggan dan memberikan pelayanan dengan tangga”.
      4. Jaminan (assurance)
      Definisi jaminan dalam Rambat Lupiyoadi (2001:148) yaitu “pengetahuan, kesopansantunan, dan kemampuan para pegawai perusahaan untuk menumbuhkan rasa percaya para pelanggan kepada perusahaan. Terdiri dari beberapa komponen antara lain komunikasi (communication), kredibilitas (credibility), keamanan (security), kompetensi (competence), dan sopan santun (courtesy)”. Senada dengan pengertian di atas Fandy Tjiptono (1996:70) mendefinisikan jaminan adalah “mencakup pengetahuan,kemampuan, kesopanan, dan sifat dapat dipercaya yang dimilikipara staff, bebas dari bahaya, risiko, atau keragu-raguan”.
      Sedangkan menurut Philip Kotler (1997:53) jaminan adalah”pengetahuan dan kesopanan dari karyawan, dan kemampuan untuk mendapatkan kepercayaan dan keyakinan”.
      5. Empati (empathy)
      Rambat Lupiyoadi (2001:148) menerangkan empati adalah “memberikan perhatian yang tulus dan bersifat individual atau pribadi yang diberikan kepada para pelanggan dengan berupaya memahami keinginan konsumen. Dimana suatu perusahaan diharapkan memiliki pengertian dan pengetahuan tentang pelanggan, memahami kebutuhan pelanggan secara spesifik, serta memiliki waktu pengoperasian yang nyaman bagi pelanggan”.
      Menurut Fandy Tjiptono (1996:70) empati adalah “kemudahan dalam melakukan hubungan, komunikasi yang baik, perhatian pribadi, dan memahami kebutuhan para pelanggan”. Lebih singkat lagi Philip Kotler (1997:53) mendefinisikan empati adalah tingkat perhatian pribadi terhadap para pelanggan”.
      Berdasarkan definisi diatas maka dapat dikatakan bahwa kepuasan pelanggan adalah perbandingan antara kinerja (hasil) pelayanan yang diberikan perusahaan di bandingkan dengan harapannya. Sejauh mana tingkat kepuasan atas kinerja melebihi harapan atau sebaliknya dimana apabila pelanggan merasa puas maka akan memberikan berbagai keuntungan.

      2.1.2. Alat Untuk Mengukur Kepuasan Pelanggan
      Menurut Philip kotler (2005:72) alat yang digunakan untuk melacak dan memgukur kepuasan pelanggan adalah:
      1. Sistem keluhan dan saran.
      Setiap organisasi yang berpusat pada pelanggan mempermudah para pelanggannya guna memasukan saran dan keluhan. Contohnya dengan menyediakan nomor telepon bebas pulsa, situs web dan e-mail untuk komunikasi dua arah yang cepat.

      2. Survey kepuasan pelanggan.
      Sejumlah penelitian menunjukan bahwa walaupun para pelanggan kecewa pada satu dari empat pembelian, kurang dari lima persen yang akan mengadukan keluhan. Kebanyakan pelanggan akan membeli lebih sedikit atau berpindah pada penyedia jasa transportasi yang lain. Perusahaan yang tanggap mengukur kepuasan pelanggan secara langsung dengan melakukan survey secara berkala, guna mengukur minat membeli ulang dan megukur kesediaan merekomendasikan perusahaan dan merek ke orang lain.
      3. Belanja siluman.
      Perusahaan dapat membayar orang untuk berperan sebgai calon pembeli guna melaporkan titik kuat dan titik lemah yang dialami sewaktu membeli produk perusahaan dan pesain. Pembelanjaan misterius ini dapat cara penjulan karyawan di perusahaan itu menangani berbagai situasi. Para manajer itu sendiri harus keluar dari kantor masuk kesituasi penjualan di perusahaannya dan pesaingnya dengan cara menyamar untuk mengetahui langsung bagaimana karyawannya berinteraksi dan memperlakukan para pelanggannya.
      4. Analisis pelanggan yang hilang
      Perusahaan harus menghubungi para pelanggan yang berhenti atau yang telah beralih keperusahaan lain guna mempelajari alasan kejadian itu. Dan supaya dapat mengambil kebijakan atau penyempurnaan selanjutnya. Serta yang penting juga adalah memantau tingkat kehilangan pelanggan.

      2.2. Loyalitas Pelanggan
      Perilaku pembelian secara berulang ulang seringkali disebut dengan loyalitas pelanggan terhadap suatu produk atau jasa. Loyalitas pelanggan terhadap suatu produk atau jasa mencerminkan komitmen psikologis terhadap barang atau jasa tertentu. oleh karena itu perilaku pembelian ulang yang semata-mata menyangkut pembelian produk atau jasa tetentu yang sama secara berulang kali. pembelian ulang merupakan hasil dominasi pasar oleh suatu perusahaan yang berhasil membuat jasanya menjadi satu-satunya alternatif yang tersedia.

      2.2.1. Pengertian Loyalitas Pelanggan
      Apabila suatu perusahaan memberikan pelayanan yang sesuai dengan harapan konsumen, maka secara tidak langsung konsumen akan mempunyai minat untuk melakukan kunjungan ulang pada perusahaan dan akn menjadi pelanggan yang loyal pada perusahaan tersebut.
      Menurut Griffin loyalitas pelanggan (2005:4) adalah: “Loyalitas pelanggan adalah Perilaku pembelian yang didefinisikan pembelian nonrandom yang di ungkapkan dari waktu kewaktu oleh beberapa unit pengambilan keputusan”. Menurut Fandy Tjiptono (2000:110) mengatakan bahwa: “Loyalitas pelanggan sebagai komitmen pelanggan terhadap suatu merek, toko, pemasok berdasarkan sikap yang sangat positif dan tercermin dalam pembelian ulang yang konsisten.”
      Dari definisi diatas dapat disimpulkan bahwa loyalitas lebih mengarah kepada perilaku (behavior) dibandingkan dengan sikap (attitude) dan seorang konsumen yang loyal akan memperlihatkan perilaku perilaku pembelian yang didefinisikan sebagai pembelian yang teratur dan di perlihatkan perilaku sepanjang oleh pembuat keputusan.
      Selanjutnya keuntungan yang akan diperoleh oleh perusahaan apabila memiliki pelanggan yang loyal adalah:
      1. Biaya pemasaran menjadi berkurang (karena biaya pengambilalihan pelanggan lebih tinggi dari pada biaya mempertahankan pelanggan).
      2. Biaya transakasi menjadi lebih rendah, seperti negosiasi kontrak pemrosesan order.
      3. Biaya perputaran pelanggan (consumer turnover), menjadi berkurang (lebih sedikit pelanggan yang harus digantikan).
      4. Keberhasilan penjualan silang (cross-selling) menjadi meningkat menyebabkan pangsa pelanggan yang lebih besar.
      5. Pemberitaan dari mulut kemulut menjadi lebih positif, dengan asumsi bahwa pelanggan yang loyal juga merasa puas.
      6. Biaya kegagalan menjadi turun (pengurangan pengerjaan ulang, klaim garansi, dan sebagainya).

      2.2.2. Karakteristik Loyalitas Pelanggan
      Pelanggan yang loyal merupakan asset penting bagi perusahaan, karena dapat diandalkan untuk memprediksi pertumbuhan penjualan dan keuangan,yang dapat didefinisikan berdasarkan perilaku membeli. Sebagaimana yang diungkapkan oleh Jil Griffin (2005:31) Pelanggan yang loyal adalah orang yang :
      1. Melakukan pembelian berulang secara teratur
      2. Membeli antar lini produk
      3. Mereferensikan kepada orang lain.
      4. Menunjukan kebal terhadap daya tarik pesaing- pesaing.

      2.2.3. Jenis-Jenis Loyalitas Pelanggan
      Menurut Griffin (2005:22) kombinasi komponen loyalitas pelanggan sebagai perilaku dan sikap menghasilkan empat loyalitas pelanggan yaitu:
      1. Tanpa loyalitas (Non loyalty)
      Keterikatan yang rendah terhadap layanan yang dikombinasikan dengan tingkat pembelian berulang yang rendah menunjukan tidak adanya loyalitas. Secara umum, perusahaan harus emnghindari membidik para pembeli jenis ini karena mereka tidak akan pernah menjadi konsumen yang loyal. Mereka hanya berkontribusi sedikit pada kekeuatan keuangan perusahaan. tantangannya dalah menghindari adalah menghindari membidik sebanyak mungkin orang seperti ini dan lebih memilih orang yang loyalitasnya dapat dikembangkan.
      2. Loyalitas lemah (Interia loyalty)
      Keterikatan yang rendah digabung dengan pembelian berulang yang tinggi menghasilkan loyalitas yang lemah. Pelanggan ini membeli karena faktor kebiasaan, dengan kata lain faktor non sikap dan faktor situasi merupakan alasan utama membeli. Pembeli ini merasakan tingkat kepuasan tertentu dengan prusahaan atau minimal tiada ketidak puasan yang nyata. Pembeli ini rentan beralih keproduk pesaing yang dapat menunjukan manfaat yang jelas. Memungkinkan bagi perusahaanuntuk megubah loyalitas lemah kedalam loylaitas yang lebih tinggi dengan secara aktif memdekati pelanggan dan meningkatkan diferensiasi positif di benak pelanggan mengenai produk anda di bandingkan dengan dengan produk pesaing.
      3. Loyalitas tersembunyi (Latent loyalty)
      Tingkat preferensi yang tinggi digabung dengan tingkat pembelian berulang yang rendah menunjukan loyalitas tersembunyi. Bila pelanggan memiliki loyalitas tersembunyi pengaruh situasi dan bukan pengaruh sikap yang mementukan pembelian berulang.
      4. Loyalitas premium (Premium loyalty)
      Loyalitas premium,jenis loyalitas yang paling dapat ditingkatkan, terjadi apabila ada tingkat keterikatan yang tinggi dan tingkat pembelian berulang yang tinggi. Ini merupakan jenis loyalitas yang paling disukai untuk semua pelanggan disetiap perusahaan. Pada tingkat preferensi paling tinggi tersebut, orang banggga karena menemukan dan menggunakan produk tertentu dan senang membagi pengetahuan mereka dengan rekan dan keluarga.

      2.2.4. Tahapan Loyalitas Pelanggan
      Tahapan loyalitas menurut Griffin (2005:35) adalah sebagai berikut:
      1. Tersangka (Suspect)
      Adalah orang yang mungkin akan membeli produk atau jasa perusahaan. Kita menyebutnya tersangka karena kita percaya atau menyangka mereka akan membeli, tetapi kita masih belum cukup yakin.
      2. Prospek (Prospect)
      Adalah orang-orang yang memiliki kebutuhan akan produk atau jasa anda dan memiliki kemampuan untuk membeli. Meskipun prospek belum membeli dari perusahaan anda, ia mungkin telah mendengar tentang perusahaan anda, membaca tentang perusahaan anda, tau ada seseorang yang merekomendasikan perusahaan anda kepadanya. Prospek mungkintahu siapa anda, dimana perusahaan anda, dan apa yang di jual oleh perusahaan tetapi masih belum membeli produk dari perusahaan anda.
      3. Prospek yang diskualifikasi (Disqualified prospect)
      Adalah prospek yang telah cukup anda pelajari untuk mengetahui bahwa mereka tidak membutuhkan atau tidak memiliki kemampuan membeli produk perusahaan anda.
      4. Pelanggan pertama kali (First time customers)
      Adalah orang yang telah membeli dari perusahaan satu kali. Orang tersebut bisa jadi merupakan pelanggan perusahaan anda dan sekaligus juga pelanggan pesaing anda.
      5. Pelanggan berulang (Repeat customers)
      Adalah orang-orang yang telah membeli dari perusahaan anda dua kali atau lebih. Mereka mungkin telah melakukan pembelian produk yang sama dua kali, atau membeli dua macam produk atau jasa yang berbeda dalam dua kesempatan yang berbeda.
      6. Clients
      Klien membeli apapun yang perusahaan anda jual dan dapat ia gunakan.. orang ini membeli secara tertatur, perusahaan memiliki hubungan yang kuat dan berlanjut, yang menjadikannya kebal terhadap tarikan pesaing.
      7. Penganjur (Advocates)
      Seperti klien, advocate membeli apapun yang perusahaan anda jual dan dapat ia gunakan serta membelinya secara teratur. Tetapi penganjur juga mendorong orang lain untuk membeli dari perusahaan anda. Ia membicarakan perusahaan anda, melakukan pemasaran bagi anda, dan membawa pelanggan kepada perusahaan anda.
      8. Patner (Patners) konsumen pada tingkat ini adalah yang mersakan saling ketergantungan dalm aktivitas bersama untuk saling mendapatkan keuntungan (patners)

      2.3. Hipotesis
      H1 : Dimensi kualitas secara simultan (bersama – sama) berpengaruh signifikan terhadap loyalitas pelanggan
      H2 : Dimensi kualitas tangible, reliability, responsiveness, assurance, empathy berpengaruh signifikan terhadap loyalitas pelanggan

      BAB III
      METODE PENELITIAN

      3.1 Jenis Data
      Data primer merupakan sumber data penelitian yang diperoleh langsung dari sumber asli. Adapun data yang digunakan dalam penelitian ini adalah sebagai berikut:
      1. Persepsi penumpang terhadap pelayanan setelah menggunakan jasa PO. Family Raya Ceria.
      2. Harapan pelanggan akan pelayanan jasa bus PO.Family Raya Ceria, berikan data sekunder merupakan data dari dokumen atau arsip perusahaan yang berhubungan dengan informasi yang berkaitan dengan penelitian, data sekunder adalah : PO. Family Raya Ceria.
      1. Sejarah singkat jasa bus PO. Family Raya Ceria.
      2. Jumlah Penjualan tiket dari tahun 2007-2011.

      3.1.1 Sumber Data
      Data yang digunakan dalam penelitian ini diperoleh dari :
      1. Perusahaan jasa
      2. Pengguna jasa
      3. Perpustakaan

      3.2 Metode Pengumpulan Data
      Dalam penelitian ini penulis menggunakan data primer dan data sekunder
      1. Data primer
      Dilakukan dengan cara menggunakan kuesioner yang berhubungan dengan lima dimensi kepuasan pelanggan. Responden memberikan respon dari item pernyataan dengan menggunakan skala likert lima angka yaitu:
      Angka 1 mewakili pernyataan sangat tidak setuju
      Angka 2 mewakili pernyataan tidak setuju
      Angka 3 mewakili pernyataan netral
      Angka 4 mewakili pernyataan setuju
      Angka 5 mewakili pernyataan sangat setuju
      2. Data Sekunder
      Pengumpulan data sekunder yang diperoleh dari membaca berbagai literatur yang berhubungan dengan objek penelitian untuk memperkuat landasan teori dan analisis dan dari data yang berkaitan dengan sejarah PO. Family Raya Ceria, perkembangan jumlah penjual tiket.

      3.3 Populasi dan Sampel
      3.3.1 Populasi
      Populasi adalah keseluruhan objek penelitian yang akan diteliti (Arikunto, 2002: 108). Populasi penelitian ini adalah seluruh pengguna jasa bus PO. Family Raya Ceria. Sampel adalah bagian populasi yang akan diteliti (Arikunto, 2002: 109). Pengambilan sampel dilakukan dengan cara purposive sampling yaitu pengambilan elemen-elemen yang dimasukkan kedalam sampel dilakukan dengan sengaja, dengan catatan sampel tersebut mewakili populasi, untuk menentukan subjeknya kurang dari 100 lebih baik diambil semua sedangkan subjeknya lebih besar dari 100 dapat diambil antara 10%-15% atau 20%-25%.

      3.4 Metode Analisis Data
      Dalam penelitian ini peneliti menggunakan metode deskriptif kualitatif yaitu semua metode untuk menganalisis data dengan menggambarkan secara sistematis mengenai pengaruh kualitas pelayanan terhadap loyalitas pelanggan jasa bus PO. Family Raya Ceria.

      3.5. Alat Analisis Data
      Data yang diperoleh dengan menggunakan alat analisis dengan alat analisis sebagai berikut:
      a. Regresi berganda yaitu alat statistic yang digunakan untuk mengetahui pengaruh tangible, realibility, responsive, assurance, emphaty terhadap loyalitas pelanggan.
      Y = a0 + b1x1 + b2b2 + b3b3 + b4b4 + b5b5
      Dimana :
      A0 = parameter konstanta
      B1 = Koefisien konstanta
      X1 = Tangible
      X2 = Reliability
      X3 = Responsive
      X4 = Asurance
      X5 = Emphaty
      b. Uji Hipotesis
      1. Uji Statistik “t”
      Yaitu alat analisis untuk menguji pengaruh secara persial tangible, reliability, responsiveness, assurance dan emphaty terhadap kualitas pelayanan. Adapun urutan uji statistik t sebagai berikut :
      1. Membuat rumusan hipotesis
      H0 : b1 = b2 = b3 = b4 = 0
      Ha : b1 = b2 = b3 = b4 = 0
      2. Tentukan tingkat signifikansi 5% dengan rumus t %2 a d f (n-1)
      3. Statistik dengan rumus

      4. Area keputusan

      5. Kriteria keputusan
      2. Uji Statistik
      Yaitu alat analisis untuk menguji pengaruh simultan antara tangible,, realibility, responsive, assurance, emphaty terhadap kualitas pelayanan. Adapun urutan uji statistic F sebagai berikut :
      1. Membuat rumusan hipotesis
      H0 : b1 = b2 = b3 = b4 = 0
      2. Tentukan tingkat signifikan a = 5%
      3. Perhitungan nilai F
      R 2 = Koefisien Determinan N = Jumlah sampel
      K = Jumlah variabel N – K = Degree of Freedom
      4. Area Keputusan

      5. Kriteria keputusan

      DAFTAR PUSTAKA

      Lupiyoadi, Rambat, 2001, Manajemen Pemasaran Jasa, Salemba Empat, Jakarta.
      Fandy, Tjiptono, 1997, Strategi Pemasaran, Edisi Kedua, Andy Offset, Yogyakarta.
      Tjiptono, Fandy. 2005. Manajemen Jasa. Andi offset. Yogyakarta :
      Rambat, Lupiyoadi, 2001, Manajemen Pemasaran Jasa : Jasa Teori dan Praktik, Edisi Pertama, Salemba Empat, Jakarta.
      Kotler, Philip, 1997, Manajemen Pemasaran : Analisis, Perencanaan, Implementasi dan Kontrol, Prentice Hall Inc.
      Philip kotler 2005. Manajemen Pemasaran Edisi Pertama. PT Indeks Kelompok Gramedia. Indonesia
      Gaspersz, Vincent. (2002). Manajemen Kualitas dalam Industri Jasa. Gramedia. :Jakarta.
      Fandy, Tjiptono, Anastasia Diana, 2000, Total Quality Management, Edisi Revisi, Andy Offset, Yogyakarta.
      suharsimi Arikunto.2002. Prosedur Penelitian Suatu Pendekatan Praktek. Rineka cipta. Jakarta
      Griffin, Jill, 2002, Customer Loyalty : How to Earn It, How to Keep It, Lexington Books, The Free Press, Singapore

      Komentar oleh alex agus saputra | Januari 25, 2012 | Balas

  100. maaf pak ralat judul, yg benar adalah ANALISIS FAKTOR EKSTERNAL YANG MEMPENGARUHI KEPUTUSAN MEMBELI MOBIL TOYOTA AVANZA di PT. AGUNG AUTOMALL JAMBI

    Priskila, segera susun proposal tentatif.

    Komentar oleh PRISKILA MUTIARA SEMBIRING | Januari 9, 2012 | Balas

  101. PENGARUH STRATEGI PEMASARAN SWALAYAN
    KEMBANG TURI AGUNG PADA TINGKAT KONSUMSI
    KONSUMEN DI WAKTU TERTENTU

    BAB 1
    PENDAHULUAN

    1.1 Latar Belakang Masalah
    Seiring dengan perkembangan ekonomi yang mempunyai beragam aktivitas pemasaran dan kebudayaan yang ada pada masyarakat membawa dampak pada pola perilaku belanja konsumen, maka tuntutan akan tempat berbelanja yang nyaman dan dapat menyediakan segala kebutuhan konsumen dalam satu swalayan semakin dibutuhkan.
    Perkembangan swalayan dan tingkat konsumsi konsumen yang terus berlangsung hendaknya dapat disadari oleh para wirausaha untuk dijadikan peluang, dengan memperhatikan pola perilaku konsumsi konsumen pada kebudayaan yang telah ada dan mengimplementasikannya terhadap strategi pemasaran dengan menawarkan pelayanan dan harga harga yang varian sehingga menarik minat konsumen untuk membeli khususnya pada waktu-waktu tertentu yang sudah menjadi bagian dari kebudayaan masyarakat sekitar seperti pada hari-hari besar idul fitri, natal.
    Mengenali pola konsumtif konsumen sangatlah menguntungkan bagi swalayan untuk dapat tetap bersaing dan survive (kelangsungan hidup perusahaan). Dengan melihat keterkaitan antara tingkat konsumsi konsumen pada saat tertentu akan menjadi sangat efektif bila menjadikannya peluang dan dihubungkan dengan kegiatan pemasaran, pastinya dengan menyadari dan memahami kebudayaan tersebut dan pola konsumsi masyarakat di waktu sebelumnya.
    Strategi pemasaran hendaknya dilakukan dengan perhitungan dan pertimbangan yang tepat sehingga tidak ada pemborosan biaya baik itu dalam operasional maupun dalam biaya promosi atau iklan dan efektifitas yang dimaksud ialah pemilihan stategi pemasaran yang tepat dan sesuai dengan keadaan pasar sehingga sasaran yang ditetapkan dapat tercapai, seperti pada swalayan penelitian ini akan difokuskan kepada strategi pemasaran dengan kelengkapan berbagai macam barang dan penataan barang yang kemudian akan mempengaruhi konsumsi konsumen terhadap waktu tertentu.
    1.2 Rumusan Masalah
    Berdasarakan latar belakang, maka rumusan masalah yang akan dibahas pada penelitian ini adalah keterkaitan antara strategi pemasaran dengan menggunakan peluang di waktu tertentu pada swalayan kembang turi, rumusan masalah dapat dijelaskan pada uraian berikut :
    I. Penjelasan strategi pemasaran pada swalayan kembang turi
    II. Keterkaitan peluang pada perilaku konsumen.
    1.3 Tujuan Penelitian
    Penelitian ini bertujuan melihat strategi pemasaran yang diterapkan oleh swalayan kembang turi agung terhadap peluang waktu yang ada, hasil yang diharapkan pada akhirnya dapat terlihat pengaruh antara efektifitas strategi pemasaran pada penjualan swalayan kembang turi agung.
    1.4 Manfaat Penelitian
    Penelitian ini diharapakan dapat membuka wawasan terhadap berbagai macam jenis strategi pemasaran yang mengikuti perkembangan jaman dan perilaku konsumsi masyarakat setempat yang menjadikan peluang pada penjualan swalayan kembang turi agung.
    I. Bagi Perusahaan
    Diharapkan penelitian ini dapat lebih meningkatkan kualitas perusahaan (swalayan) melakukan berbagai aktivitas terutama dalam bidang pemasaran, dapat lebih membuka inspirasi dan wawasan bagi pihak swalayan untuk terus survive ditengah gencarnya persaingan pada masa ini, selain itu diharapkan perusahaan dapat melihat dan menganalisis lebih dalam peluang yang ada di sekitar perusahaan terkait pada kepentingan perusahaan.
    II. Bagi Peneliti
    Peneliti diharapkan untuk dapat melihat, menganalisis, dan mengemukakan lebih banyak realiti strategi pemasaran yang ada di lapangan dan mengimplementasikannya pada konsep pembelajaran yang, diharapkan pada analisis tersebut penulis dapat menjadikannya sebagai pengalaman dan menemukan hal yang baru terkait pada strategi pemasaran dan peluang pasar.
    III. Bagi Pihak Universitas
    Penelitian ini dapat memberikan kontribusi kepada pihak universitas berupa akademis dan menjadikan hasil dari penelitian ini sebagai salah satu referensi diantara banyaknya ilmu-ilmu dan konsep yang terkait pada bidang ilmu pemasaran

    Komentar oleh wulan16 | Januari 10, 2012 | Balas

  102. ANALISIS FAKTOR EKSTERNAL YANG MEMPENGARUHI KEPUTUSAN MEMBELI MOBIL TOYOTA AVANZA di PT AGUNG AUTOMALL JAMBI

    BAB I
    PENDAHULUAN

    1.1 Latar Belakang
    Penjualan mobil Toyota Avanza diperkirakan akan mengalami peningkatan kembali pada tahun 2012. Hingga Dersember 2011, jumlah penjualan mobil ini di PT Agung Automall Jambi telah mencapai 5714 unit mobil. Walaupun harga bahan bakar minyak (BBM) mengalami peningkatan dan menyebabkan kenaikan harga barang lain, namun tidak mempengaruhi penjualan mobil Toyota Avanza.
    Sejak pertama kali diluncurkan tahun 2004, Toyota Avanza menunjukkan dominasinya dalam peningkatan penjualan mobil nasional. Penjualan Toyota Avanza terus mengalami peningkatan setiap tahunnya hingga mencapai posisi teratas di tahun 2006, 2007 dan 2008.
    Menurut Senior Managing Director TMC, selera konsumen telah mengalami perubahan demikian juga dengan kebutuhan konsumen. Kebutuhan konsumen mengarah pada kendaraan yang kompak, memiliki performa dan kualitas tinggi, serta dengan harga terjangkau. Agar mereknya tetap eksis di pasar, TMC berupaya menciptakan kategori baru, dan masuki segmen baru untuk merevitalisasi merek yang sudah ada. Upaya tersebut diwujudkan melalui kerja sama dengan Daihatsu Motor Co. Ltd., dimana 51 persen sahamnya dimiliki oleh TMC. Setelah melakukan riset selama dua tahun, akhirnya TMC dan Daihatsu Motor memproduksi mobil dengan kategori Multy Purpose Vehicle (MPV) yang dinamakan Toyota Avanza dan Daihatsu Xenia. Di Indonesia, PT Astra Daihatsu Motor (ADM) dipercaya memproduksi mobil kedua mobil tersebut. Selama ini, mobil dengan kategori MPV dikuasi oleh Toyota kijang dengan sasaran pasar kalangan menengah ke atas. Diluncurkannya Avanza dan Xenia diharapkan mampu memenuhi kebutuhan masyarakat akan mobil keluarga dengan harga yang terjangkau.
    Avanza menampilkan eksterior yang stylish dan interior yang nyaman serta canggih. Dimensinya yang memiliki panjang badan 4 meter, memuat tiga barisan kursi (six seater) berkapasitas tujuh penumpang dengan ruang yang cukup lebar. Avanza hadir dengan kapasitas mesin 1.3 liter dan 1.5 liter. Avanza memiliki model yang sporty, trendy dan sangat kompak. Sedangkan Xenia, di samping modelnya yang kompak, memiliki harga murah dan konsumsi bahan bakar yang irit. Walaupun Xenia dijual dengan harga yang lebih murah dan irit bahan bakar, namun konsumen lebih memilih untuk membeli Avanza.
    Kendaraan dengan kategori MPV menguasai hampir 60 persen pangsa pasar otomotif. Menurut PT Agung Automall Jambi, tingginya minat masyarakat terhadap kotegori MPV karena karakter masyarakat Indonesia berbeda dengan karakter masyarakat Eropa. Masyarakat Indonesia sangat kekeluargaan. Mereka lebih menyukai bepergian dengan orang banyak, dengan keluarga, saudara ataupun teman. Sementara, masyarakat Eropa lebih mengutamakan individualistiknya. Dengan sifat family minded seperti ini, masyarakat sangat memperhatikan kapasitas kendaraan yang mampu membawa seluruh keluarga.
    Pernyataan yang sama juga diungkapkan oleh Marketing Communications PT Toyota Astra Motor (TAM). Menurutnya pada kondisi ekonomi makro Indonesia yang belum stabil ini, masyarakat yang berminat untuk membeli kendaraan akan memfokuskan pada kegunaan (fungsi) kendaraan bersangkutan dan harganya terjangkau. Itu sebabnya kendaraan yang irit dan mampu menampung seluruh anggota keluarga, akan menjadi pilihan masyarakat.

    1.2 Perumusan Masalah
    Berdasarkan latar belakang di atas, maka dirumuskan masalah sebagai berikut:
    1. Sejauhmana pengaruh strategi bauran pemasaran yang terdiri dari: produk dan harga, terhadap minat konsumen membeli mobil Toyota Avanza di PT Agung Automall Jambi?
    2. Sejauhmana pengaruh lingkungan sosial konsumen yang terdiri dari: keluarga dan kelompok rujukan, terhadap keputusan konsumen membeli mobil Toyota Avanza di PT Agung Automall Jambi?

    1.3 Tujuan penelitian
    Tujuan dari penelitian adalah:
    1. Untuk mengetahui dan menganalisis pengaruh strategi bauran pemasaran yang terdiri dari: produk dan harga, terhadap minat konsumen membeli mobil Toyota Avanza di PT Agung Automall Jambi.
    2. Untuk mengetahui dan menganalisis pengaruh lingkungan sosial konsumen yang terdiri dari: keluarga dan kelompok rujukan, terhadap keputusan konsumen membeli mobil Toyota Avanza di PT Agung Automall Jambi.

    1.4 Manfaat Penelitian
    Adapun manfaat yang dapat diperoleh dari penelitian adalah:
    1. Sebagai bahan masukan bagi PT Agung Automall Jambi menentukan kebijakan dan pengembangan strategi pemasaran yang sesuai dengan kebutuhan pasar.
    2. Sebagai penambah khasanah penelitian bagi Program Studi Ilmu Manajemen Pascasarjana Universitas Jambi yang dapat dipergunakan dan dikembangkan.
    3. Sebagai penambah dan memperluas pengetahuan bagi peneliti dalam bidang pemasaran khususnya perilaku konsumen yang berkaitan dengan pengambilan keputusan pembelian.
    4. Sebagai bahan referensi bagi peneliti selanjutnya yang akan melakukan penelitian pemasaran di masa yang akan datang.

    Komentar oleh PRISKILA MUTIARA SEMBIRING | Januari 10, 2012 | Balas

    • mohon masukannya ya pak..

      Komentar oleh PRISKILA MUTIARA SEMBIRING | Januari 11, 2012 | Balas

  103. PENGARUH STRATEGI PEMASARAN SWALAYAN
    KEMBANG TURI AGUNG PADA TINGKAT KONSUMSI
    KONSUMEN DI WAKTU TERTENTU

    (PROPOSAL SKRIPSI)

    Diajukan oleh
    Sulastry wulandary
    C1B009045

    Kepada
    JURUSAN EKONOMI MANAJEMEN
    UNIVERSITAS JAMBI
    BAB 1
    PENDAHULUAN

    1.1 Latar Belakang Masalah
    Seiring dengan perkembangan ekonomi yang mempunyai beragam aktivitas pemasaran dan kebudayaan yang ada pada masyarakat membawa dampak pada pola perilaku belanja konsumen, maka tuntutan akan tempat berbelanja yang nyaman dan dapat menyediakan segala kebutuhan konsumen dalam satu swalayan semakin dibutuhkan.
    Perkembangan swalayan dan tingkat konsumsi konsumen yang terus berlangsung hendaknya dapat disadari oleh para wirausaha untuk dijadikan peluang, dengan memperhatikan pola perilaku konsumsi konsumen pada kebudayaan yang telah ada dan mengimplementasikannya terhadap strategi pemasaran dengan menawarkan pelayanan dan harga harga yang varian sehingga menarik minat konsumen untuk membeli khususnya pada waktu-waktu tertentu yang sudah menjadi bagian dari kebudayaan masyarakat sekitar seperti pada hari-hari besar idul fitri, natal.
    Mengenali pola konsumtif konsumen sangatlah menguntungkan bagi swalayan untuk dapat tetap bersaing dan survive (kelangsungan hidup perusahaan). Dengan melihat keterkaitan antara tingkat konsumsi konsumen pada saat tertentu akan menjadi sangat efektif bila menjadikannya peluang dan dihubungkan dengan kegiatan pemasaran, pastinya dengan menyadari dan memahami kebudayaan tersebut dan pola konsumsi masyarakat di waktu sebelumnya.
    Strategi pemasaran hendaknya dilakukan dengan perhitungan dan pertimbangan yang tepat sehingga tidak ada pemborosan biaya baik itu dalam operasional maupun dalam biaya promosi atau iklan dan efektifitas yang dimaksud ialah pemilihan stategi pemasaran yang tepat dan sesuai dengan keadaan pasar sehingga sasaran yang ditetapkan dapat tercapai, seperti pada swalayan penelitian ini akan difokuskan kepada strategi pemasaran dengan kelengkapan berbagai macam barang dan penataan barang yang kemudian akan mempengaruhi konsumsi konsumen terhadap waktu tertentu.
    1.2 Rumusan Masalah
    Berdasarakan latar belakang, maka rumusan masalah yang akan dibahas pada penelitian ini adalah keterkaitan antara strategi pemasaran dengan menggunakan peluang di waktu tertentu pada swalayan kembang turi, rumusan masalah dapat dijelaskan pada uraian berikut :
    I. Penjelasan strategi pemasaran pada swalayan kembang turi
    II. Keterkaitan peluang pada perilaku konsumen.
    1.3 Tujuan Penelitian
    Penelitian ini bertujuan melihat strategi pemasaran yang diterapkan oleh swalayan kembang turi agung terhadap peluang waktu yang ada, hasil yang diharapkan pada akhirnya dapat terlihat pengaruh antara efektifitas strategi pemasaran pada penjualan swalayan kembang turi agung.
    1.4 Manfaat Penelitian
    Penelitian ini diharapakan dapat membuka wawasan terhadap berbagai macam jenis strategi pemasaran yang mengikuti perkembangan jaman dan perilaku konsumsi masyarakat setempat yang menjadikan peluang pada penjualan swalayan kembang turi agung.
    I. Bagi Perusahaan
    Diharapkan penelitian ini dapat lebih meningkatkan kualitas perusahaan (swalayan) melakukan berbagai aktivitas terutama dalam bidang pemasaran, dapat lebih membuka inspirasi dan wawasan bagi pihak swalayan untuk terus survive ditengah gencarnya persaingan pada masa ini, selain itu diharapkan perusahaan dapat melihat dan menganalisis lebih dalam peluang yang ada di sekitar perusahaan terkait pada kepentingan perusahaan.
    II. Bagi Peneliti
    Peneliti diharapkan untuk dapat melihat, menganalisis, dan mengemukakan lebih banyak realiti strategi pemasaran yang ada di lapangan dan mengimplementasikannya pada konsep pembelajaran yang, diharapkan pada analisis tersebut penulis dapat menjadikannya sebagai pengalaman dan menemukan hal yang baru terkait pada strategi pemasaran dan peluang pasar.
    III. Bagi Pihak Universitas
    Penelitian ini dapat memberikan kontribusi kepada pihak universitas berupa akademis dan menjadikan hasil dari penelitian ini sebagai salah satu referensi diantara banyaknya ilmu-ilmu dan konsep yang terkait pada bidang ilmu pemasaran

    BAB II
    METODE PENELITIAN
    2.1 Jenis Penelitian
    Objek dan pembahasan yang akan dijelaskan pada penelitian ini adalah strategi pemasaran yang dilakukan oleh swalayan kembang turi, peluang beserta keterkaitannya pada perilaku konsumen. Penelitian ini menggunakan metode deskriptif dengan pendekatan kualitatif , dimana menurut Moh Nazir Ph.d. (1988 hal 63, 64) dalam Buku “Metode Penelitian” metode deskriptif merupakan suatu metode dalam meneliti status sekelompok manusia, suatu objek, suatu set kondisi, suatu sistem pemikiran ataupun suatu kelas peristiwa pada masa sekarang. Tujuan dari penelitian deskriptif ini adalah untuk membuat deskripsi, gambaran, atau lukisan secara sistematis, faktual dan akurat mengenai fakta-fakta, sifat-sifat serta hubungan antarfenomena yang diselidiki.
    Sedangkan kualitatif menurut Bogdan dan Taylor mengatakan metodologi kualitatif sebagai prosedur penelitian yang menghasilkan data deskriptif berupa kata-kata tertulis atau lisan dari orang-orang dan perilaku yang dapat diamati. Para ahli lain seperti Denzin dan Lincoln mengatakan secara umum penelitian kualitatif sebagai suatu proses dari berbagai langkah yang melibatkan peneliti, paradigma teoritis dan interpretatif, strategi penelitian, metode pengumpulan data dan analisis data empiris, maupun pengembangan interpretasi dan pemaparan. Berkaitan dengan penelitian metode deskriptif dengan pendekatan kualitatif sangat memungkinkan untuk digunakan.
    2.2 Populasi dan Sample Penelitian
    2.2.1 Populasi
    Populasi merupakan subjek keseluruhan dan bagian dari sample menurut prof.Dr suharsimi arikunto. (2002,108) dalam bukunya prosedur penelitian suatu pendekatan praktek mengatakan bahwa populasi adalah keseluruhan subjek penelitian apabila seseorang meneliti semua elemen yang ada dalam wilayah penelitian, maka penelitiannya merupakan penelitian populasi, studi atau penelitiannya juga disebut studi populasi atau studi sensus.
    Menurut pengertiannya, populasi pada penelitian ini adalah konsumen swalayan kembang turi agung, pengambilan populasi dimaksudkan untuk mendapatkan hasil yang diinginkan terkait pada penelitian.
    2.2.2 Sample
    Sample merupakan sebagian subjek yang diambil dari populasi, menurut prof.Dr Suharsimi arikunto (2002 Hal 109) dalam bukunya prosedur penelitian suatu pendekatan praktek, mengatakan bahwa sampel adalah sebagian atau wakil populasi yang diteliti. Agar sampel yang diambil mewakili data penelitian, maka perlu adanya perhitungan besar kecilnya populasi.
    Teknik penentuan sample pada penelitian ini menggunakan Simple Random Sampling yaitu semua data yang ada pada populasi mempunyai kesempatan untuk dapat dipilih menjadi sample dan dengan pertimbangan bahwa pada penelitian ini perbedaan karakter populasi seperti umur, jenis kelamin, dan gender tidak terlalu penting dan tidak ada pengaruh yang signifikan terhadap hasil penelitian, maka dari itu dapat menggunakan sample acak sederhana dalam penelitian ini.
    2.3 Operasionalisasi Variabel
    Operasionalisasi variabel dalam penelitian ini bertujuan untuk memudahkan atau mengarahkan dalam menyusun alat ukur data yang diperlukan berdasarkan kerangka konseptual penelitian yang telah dikemukakan, menjelaskan beberapa makna yang menjadi variabel dalam pada penelitian ini, operasionalisasi variabel terbagi dari dua, yaitu sebagai berikut :

    2.3.1 Variabel Bebas (Independent variable)
    Variabel ini merupakan penjelasan dari pengaruh strategi pemasaran swalayan kembang turi agung di waktu waktu tertentu dengan menggunakan notasi (X), berikut penjelasan definisi operasional dari masing-masing variabel:

    I. Pengaruh
    Pengaruh merupakan hubungan sebab akibat atau suatu tindakan dan interaksi baik langsung atau tidak langsung yang dilakukan seseorang atau sekelompok orang yang mengakibatkan suatu perubahan pada pihak lain. istilah pengaruh pada penelitian ini dikonsepkan sebagai hasil yang berdampak pada konsumen dari kegiatan strategi pemasaran yang dilakukan oleh swalayan kembang turi agung, dengan menggunakan notasi (X1).

    II. Strategi Pemasaran
    Strategi pemasaran adalah serangkaian aktivitas perusahaan yang terencana dan mempunyai tujuan tertentu terkait dengan kepentingan perusahaan tersebut. Menurut Fendy tciptono, “Strategi pemasaran adalah alat fundamental yang direncankan untuk mencapai tujuan perusahaan dengan mengembangkan keunggulan bersaing yang berkesinambungan melalui pasar yang dimasuki dan program pemasaran yang digunakan untuk melayani pasar sasaran tersebut”.

    Pada penelitian ini strategi pemasaran di konsepkan menjadi notasi (X2), dan terdapat beberapa strategi pemasaran yaitu sebagai berikut :
    a) Melihat peluang pasar dari segi waktu
    b) Melengkapi ketersediaan barang
    c) Mengatur Letak dan tata ruang pada swalayan

    2.3.2 Variabel terikat (dependent variable)
    Variabel ini menjelaskan tingkat konsumsi konsumen di waktu tertentu, dimana pada saat tertentu keadaan tingkat pendapatan pada swalayan mengalami peningkatan konsumsi konsumen ketika strategi pemasaran dilakukan, variabel ini menggunakan notasi (Y).

    Daftar Pustaka

    Moh Nazir Ph.d.1988. Metode Penelitian
    suharsimi arikunto prof.Dr. 2002. prosedur penelitian suatu pendekatan praktek
    Bogdan dan Taylor 1975. Metodologi Penelitian Kualitatif karya Lexy J. Moleong. Rosda
    http://www.wikipedia.org/
    http://www.google.co.id/

    Sulastry, judulmu terlalu luas. Kalau hendak meneliti strategi, ambil saja satu komponennya. Misalnya pengaruh strategi harga, diskon dan lain-lain. Ini lebih baik dan cepat untuk dilaksanakan.

    Komentar oleh johannessimatupang | Januari 11, 2012 | Balas

  104. Mariaty, batasan sampelmu masih belum sesuai.

    Komentar oleh Mariaty Sitompul | Januari 11, 2012 | Balas

    • pak saya sudah kirim populasi dan sampel
      operasional variabel jg sudah pak

      Komentar oleh Mariaty Sitompul | Januari 15, 2012 | Balas

  105. Komentar baru pada “METODE PENELITIAN NOVEMBER PAGI DAN SORE”
    Penulis : Mariaty Sitompul (IP: 110.137.122.242 , 242.subnet110-137-122.speedy.telkom.net.id)
    E-mail : marstomp_31@yahoo.com
    URL :
    Whois : http://whois.arin.net/rest/ip/110.137.122.242
    Komentar:
    nama : Mariaty sitompul
    Nim : C1B009015

    PROPOSAL SKRIPSI

    ANALISIS FAKTOR PSIKOLOGIS TERHADAP KEPUTUSAN MEMILIH JASA PENDIDIKAN BAHASA INGGRIS DI LBPP-LIA-JAMBI

    BAB I
    PENDAHULUAN

    1. latar Belakang Penelitian
    Sudah lama penguasaan bahasa Inggris menjadi pengetahuan yang perlu dipelajari oleh orang Indonesia. Mulai dari tahun 60’an hingga sekarang, pelajaran bahasa Inggris menjadi subyek yang tidak kalah gengsinya dari pelajaran lain seperti Matematika dan IPA. Besarnya kebutuhan untuk belajar bahasa Inggris telah membuat pengetahuan ini menjadi sebuah komoditas bisnis tersendiri. Lembaga pengajaran bahasa Inggris swasta pun bermunculan seperti LIA, Jakarta College, Oxford, BBC, IEC, EF, TBI dan lain-lainnya. Orang tua kemudian seperti berlomba-lomba untuk mengirimkan anak mereka untuk mengikuti kursus di salah satu lembaga pengajaran bahasa Inggris yang sudah disebutkan di atas. Jika dulu anak Indonesia baru mempelajari bahasa Inggris pada tingkat SMA, sekarang mereka memulainya pada tingkat yang lebih dini, SD, dan kalau perlu TK. Oleh karena orang Indonesia masih menganut budaya Timur yang agak totok, anak tidak boleh protes apabila diharuskan ayah ibunya untuk mempelajari bahasa Inggris. Lucunya, banyak orang tua yang mengharuskan anaknya mengikuti kursus bahasa asing yang satu ini tanpa mampu memberikan satu alasan yang jelas mengapa bahasa Inggris itu penting bagi mereka.
    Lembaga Bahasa dan Pendidikan Professional LBPP-LIA-Jambi merupakan salah satu lembaga pengajaran bahasa inggris ternama di jambi, tidak heran bila konsumen tetap memilih LIA sebagai lembaga yang bergerak dalam bidang jasa pendidikan walaupun dengan biaya yang lebih mahal dibandingkan dengan lembaga lain. Perilaku konsumen dalam mengambil keputusan tersebut dapat dipengaruhi oleh factor kultur, social, pribadi, dan psikologis.
    Factor yang paling mempengaruhi konsumen adalah factor psikologis, psikologis konsumen dipengaruhi lewat media massa (Koran, majalah, TV, radio, internet, dan lain-lain). Dengan mengetahui factor yang mempengaruhi keputusan pembelian diharapkan dapat memberikan pelayanan jasa yang sesuai dengan harapan konsumen, sehingga keputusan pembelian dapat meningkat.
    Berdasarkan uraian diatas maka penulis sangat tertarik untuk melakukan penelitian yang berjudul “Analisi Faktor Psikologis Terhadap Keputusan Memilih Jasa Pendidikan Bahasa Inggris Di LBPP-LIA-JAMBI.”

    2. Rumusan Masalah
    Sikap pembelian psikologis dipengaruhi oleh empat factor utama, yaitu : motivasi, persepsi, pembelajaran dan kepercayaan. Motivasi merupakan kebutuhan yang mendorong seseorang dalam melakukan sesuatu sesuai dengan tujuan yang dicapai. Melalui motivasi proses pengamatan dan belajar seseorang memperoleh kepercayaan terhadap suatu produk yang secara otomatis mempengaruhi perilaku pembelian konsumen.
    Keputusan Pemilihan jasa pendidikan LIA bagi para konsumen dapat dilakukan penelitian terlebih dahulu, sehingga dapat menilai keinginan dan perilakunya. Mengingat LIA sebagai lembaga ternama di Jambi dengan biaya yang cukup mahal namun konsumen tetap memilihnya dan semua yang telah diuraikan pada latar belakang, maka yang menjadi permasalahan adalah “Bagaimana factor psikologis terhadap keputusan memilih jasa pendidikan bahasa inggris di LBPP-LIA-JAMBI?”

    3. Tujuan Penelitian
    1. Untuk mengetahui factor psikologis terhadap keputusan memilih jasa
    pendidikan di LBPP-LIA-JAMBI
    2. Untuk menganalisis factor psikologis terhadap keputusan memilih jasa pendidikan di LBPP-LIA-JAMBI

    Mariaty, judulmu ok saja. Tambahkan daftar pusaka dan perbaikan terhadap tujuan dan manfaat penelitian.

    Komentar oleh johannessimatupang | Januari 11, 2012 | Balas

    • makasih pak buat masukannya…
      segera saya perbaiki.

      Komentar oleh Mariaty Sitompul | Januari 15, 2012 | Balas

  106. Nama : M.zuhdi azwar
    Nim : C1B008054
    Tugas proposal skripsi MEP

    ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI

    BAB1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian
    Persaingan produk yang semakin ketat yang ditandai dengan munculnya persaingan untuk produk sejenis dengan berbagai kemudahan dan tingkat harga yang relatif lebih rendah, mendorong setiap perusahaan untuk lebih meningkatkan image terhadap produk yang ditawarkannya. Karena persaingan yang ada akan membuat konsumen semakin banyak pilihan dengan berbagai merek dalam melaksanakan keputusan pembelian dengan harga yang bervariasi di pasaran yang tersebar di berbagai daerah. Dalam kondisi yang demikian, perusahaan tidak dapat hanya memusatkan perhatiannya pada produk yang ditawarkan tetapi juga membuat strategi yang tepat agar produk yang dihasilkan dapat menarik perhatian konsumen dari berbagai macam produk yang ditawarkan oleh pesaing lainnya.
    Banyaknya jenis kendaraan bermotor roda dua yang ditawarkan pada saat ini dengan berbagai keunggulan yang ada merupakan suatu keuntungan bagi konsumen. Konsumen dapat memilih sesuai dengan kriteria yang diinginkannya. Criteria ini menjadi pendorong utama mereka dalam kepuasan pembelian kendaraan bermotor roda dua. Beberapa jenis kendaraan roda dua dengan berbagai spesifikasi menawarkan kemudahaan dan keunggulan, mulai dari pembelian hingga perawatan. Masing-masing agen dan dealer berlomba merebut pasar yang ada.
    Untuk lebih jelasnya penjualan kendaraan bermotor roda dua merek Honda di Kota Jambi dapat dilihat pada tabel berikut ini :

    Tabel 1.1 Total Penjualan Kendaraan Bermotor Roda Dua Merek Honda di Kota Jambi Tahun
    2001-2005
    Tahun Total penjualan Honda (Unit) Pangsa Pasar
    2001 23.657 18.668 78,91
    2002 24.324 19.325 79,44
    2003 28.030 20.731 73,96
    2004 30.246 21.009 69,46
    2005 35.650 24.938 69,95
    Rata-rata 74,34
    Sumber : PD. Sinar Sentosa

    Tabel 1.1 di atas menunjukkan bahwa selama tahun 2001-2005 pangsa pasar kendaraan bermotor roda dua merek Honda di Kota Jambi rata-rata sebesar 74,34 persen. Hal ini menunjukkan bahwa kendaraan bermotor roda dua merek Honda menguasai sebagian besar penjualan kendaraan bermotor roda dua di Kota Jambi. Namun demikian, menilik perkembangan data pangsa pasar di atas terlihat terjadinya penurunannya penjualan pada tahun 2003 yakni sebesar 73,96 persen, dan terus mengalami penurunannya di bawah 70 persen pada tahun 2004 dan 2005. Hal ini sebagai cerminan semakin ketatnya persaingan dalam merebut pangsa pasar kendaraan bermotor, khusunya di Kota Jambi.
    Pada dasarnya tujuan suatu bisnis adalah untuk menciptakan pelanggan yang merasa puas. Terciptanya kepuasan akan memberikan dampak diantaranya hubungan yang baik antara perusahaan dan dan konsumen, memberikan dasar yang baik bagi pembelian ulang dan loyalitas pelanggan dan membentuk suatu rekomendasi dari mulut ke mulut yang menguntungkan perusahaan.
    Berdasarkan uraian di atas, terlihat bahwa kepuasan konsumen dalam pembelian produk motor merek Honda mempengaruhi perilaku untuk mengkonsumsinya. Oleh karena itu peneliti tertarik untuk mengetahui gambaran kepuasan konsumen dalam melakukan pembelian motor merek Honda secara lebih lanjut dalam bentuk skripsi dengan judul :
    “ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI’’.

    1.2 Perumusan Masalah
    Kendaraan bermotor merk Honda selama periode 2001-2005 menguasai pangsa pasar kendaraan bermotor roda dua lebih dari 74,34 persen.keberhasilan ini tidakterlepas dari kepuasan konsumen dalam memperoleh pelayanan kepuasan konsumen. Namun demin demikian dengan penurunan penguasaan pangsa pasar selama dua tahun terakhir dibawah 70% mengidikasikan semakin ketatnya persaingan penjualan kendaraan bermotor roda dua merk Honda.
    Dariuraian diatas maka masalah yang akan diteliti adalah sebagaiberikut:
    “ Bagaimana tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi?’’

    1.3 Tujuan Penelitian dan Manfaat Penulisan
    1.3.1 Tujuan Penelitian
    adapun tujuan penelitian ini adalah :
    1. Untuk mengukur tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.
    2. Untuk menganalisis tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.

    1.3.2 Manfaat Penelitian
    Adapun manfaat penelitian ini adalah :
    1. Secara akdemis hasil penelitian ini diharapkan menjadi salah satu referensi bagi penelitian-penelitian selanjutnya untuk menguji topic yang sama dengan penelitian ini.
    2. Secara praktis hasil penelitian ini diharapkan menjadi sumbangan pemikiran bagi agen tunggal pemegang merek, khususnya Honda dalam memperluas pasar.

    BAB II
    TINJAUAN PUSTAKA
    2.1 Definisi-Definisi
    Menurut William.J. Stanton (1997, hal 7) Pemasaran adalah suatu system total dari kegiatan bisnis yang direncanakan untuk menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan baik kepada konsumen saat ini maupun konsumen potensial.
    Menurut P. Kothler (1994, hal 4) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan konsep, penetapan harga, promosi dan distribusi barang dan jasa untuk menghasilkan pertukaran yang memenuhi sasaran perorangan dan organisasi.

    Komentar oleh M.ZUHDI AZWAR | Januari 11, 2012 | Balas

  107. Nama : Ayu Pratiwi
    NIM : C1B008055
    Tugas Proposal Skripsi MEP

    ANALISIS PERILAKU KONSUMEN DALAM MEMUTUSKAN MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD.
    BAB 1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian

    Pada dasarnya produk Mie Instan diketahui adalah salah satu produk makanan cepat saji yang semakin lama semakin banyak digemari oleh masyarakat khalayak luas,karena proses pembuatannya yang mudah membuat masyarakat tidak perlu susah payah membuatnya. Produk ini pun biasa dikonsumsi dengan harga yang relative terjangkau,mudah didapatkan dan sifatnya tahan lama.
    Produk ini pun bisa dibeli dari kalangan bawah sampai menengah atas, dan produk yang dikeluarkan mie instan ini pun tentunya beragam. Dari segi kemasan serta peningkatan kualitasnya pun masih berbeda. Dengan semakin banyaknya merek mie instan yang ada di pasaran berarti memberikan keleluasan bagi konsumen untuk memilih merek yang sesuai dengan keinginannya. Oleh karena itu sangat perlu bagi perusahaan untuk menganalisis perilaku konsumen untuk mengetahui pola pembeliannya. Dengan banyaknya merek mie instan yang ada dipasaran akan mendorong perusahaan bersaing mendapatkan calon konsumen melalui berbagai stategi yang tepat. Misalnya mengubah kemasan yang menarik, aroma, warna, promosi dan harga.
    Minat beli adalah kecenderungan responden untuk bertindak sebelum keputusan benar-benar membeli dilaksanakan. Terdapat perbedaan antara pembelian aktual dan minat pembelian ulang. Bila pembelian aktual adalah pembelian yang benar-benar dilakukan oleh konsumen. Maka minat pembelian ulang adalah niat untuk melakukan pembelian kembali kepada kesempatan mendatang.
    Keinginan untuk membeli merupakan tendensi konsumen untuk membeli suatu produk. Pengukuran keinginan untuk membeli tersebut merupakan suatu hal yang penting dalam pengembangan strategi. Selain itu perlu diperhatikan bahwa keputusan untuk membeli suatu produk dipengaruhi oleh dua hal yaitu sikap dan pendirian orang lain dan faktor situasi yang tidak diantisipasi. Sampai dimana pengaruh orang tersebut terdapat memutuskan minat beli konsumen ditentukan oleh intensitas dari pendirian negatif orang lain terhadap alternatif yang disuka konsumen dan motivasi konsumen untuk menuruti orang lain. Sedangkan pengaruh faktor situasi yang diantisipasi terhadap minat beli konsumen didasarkan pada faktor seperti pendapatan keluarga yang diharapkan, dan melihat produk yang diharapkan. Produsen pun harus lebih jauh lagi dalam mendistribusikan produknya kepasar konsumen berusaha agar produknya dapat diterima dengan sesuai apa yang diinginkan oleh konsumen.
    Tabel 1.1 berikut memperlihatkan berbagai macam variasi, harga dan rasa dari mie instan merek Indofood antara lain :

    Tabel 1.1
    Daftar Harga dan Variasi Mie instan Pada
    Merek Indofood
    No Nama Produk Harga Persatuan Harga Per Dus
    1 Indomie Kuah Kari Rp 1.400 Rp 48.272
    2 Indomie Kuah Ayam Bawang Rp 1.400 Rp.48.272
    3 Indomie Goreng Rp 1.500 Rp 49.500
    Sumber : PT.Indomaret

    Tabel 1.1 diatas menunjukkan adanya perbedaan harga dan variasi dari mie instan pada merek Indofood. Perlu diketahui mie instan yang pangsa pasarnya selama ini dikuasai oleh PT.Indofood, kini pangsa pasarnya semakin kecil dengan masuknya banyak pendatang baru mie instan.
    Oleh karena itu menjadi menarik untuk melakukan penelitian mengenai kebijaksanaan tersebut dan melaporkan hasilnya dalam bentuk skripsi dengan judul “ANALISIS PERILAKU KONSUMEN DALAM MEMUTUSKAN MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD’’.

    1.2 Perumusan Masalah
    “ Bagaimana tingkat kepuasan konsumen dalam memutuskan membeli produk mie instan merek Indofood ’’

    1.3 Tujuan Penelitian dan Manfaat Penelitian
    1.3.1 Tujuan Penelitian
    Penelitian ini bertujuan :
    1. Untuk memperoleh tingkat kepuasan konsumen dalam memutuskan pembelian produk mie instan merek Indofood.
    2. Untuk menganalisis perilaku konsumen dalam memutuskan membeli produk mie instan merek Indofood.
    1.3.2 Manfaat Penelitian

    Manfaat yang diharapkan dari adanya penelitian ini adalah :
    1. Hasil penelitian menjadi bahan penulisan skripsi yang merupakan salah satu syarat memperoleh gelar sarjana ekonomi.
    2. Hasil penelitian ini dapat menjadi masukan bagi PT.Indofood Jambi dimasa yang akan datang dalam usahanya untuk meningkatkan kinerja penjualannya.
    3. Dapat menjadi referensi bagi orang-orang yang berminat terhadap topik ini.

    BAB II

    TINJAUAN PUSTAKA

    2.1 Definisi-definisi
    Untuk memperjelas penulisan ini, maka perlu kiranya dikemukakan berupa pengertian :
    1. Manajemen
    Menurut Terry dan Rue (2001, hal 1) Manajemen adalah suatu proses atau kerangka kerja yang melibatkan bimbingan atau pengarahan suatu kelompok orang-orang ke arah tujuan-tujuan organisasional atau maksud-maksud yang nyata.
    2. Pemasaran
    Menurut Kotler (2002, hal 9) pemasaran adalah suatu proses sosial yang di dalamnya individu atau kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan dan secara bebas mempertukarkan produk yang bernilai dengan pihak lain.

    3. Manajemen Pemasaran
    Menurut Kotler (2002, hal 9) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan pemikiran, penetapan harga, promosi serta penyaluran gagasan, barang dan jasa untuk menciptakan pertukaran yang memenuhi sasaran-sasaran individu dan organisasi.
    4. Produk
    Menurut Angipora (2002, hal 4) Produk adalah sesuatu yang dapat ditawarkan pada suatu pasar untuk mendapatkan perhatian untuk dimiliki, penggunaan ataupun konsumsi yang bisa memuaskan keinginan ataupun kebutuhan.
    5. Promosi
    6. Keputusan Pembeli

    Komentar oleh Ayu Pratiwi | Januari 11, 2012 | Balas

  108. Nama : M.zuhdi azwar
    Nim : C1B008054
    Tugas proposal skripsi MEP

    ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI

    BAB1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian
    Persaingan produk yang semakin ketat yang ditandai dengan munculnya persaingan untuk produk sejenis dengan berbagai kemudahan dan tingkat harga yang relatif lebih rendah, mendorong setiap perusahaan untuk lebih meningkatkan image terhadap produk yang ditawarkannya. Karena persaingan yang ada akan membuat konsumen semakin banyak pilihan dengan berbagai merek dalam melaksanakan keputusan pembelian dengan harga yang bervariasi di pasaran yang tersebar di berbagai daerah. Dalam kondisi yang demikian, perusahaan tidak dapat hanya memusatkan perhatiannya pada produk yang ditawarkan tetapi juga membuat strategi yang tepat agar produk yang dihasilkan dapat menarik perhatian konsumen dari berbagai macam produk yang ditawarkan oleh pesaing lainnya.
    Banyaknya jenis kendaraan bermotor roda dua yang ditawarkan pada saat ini dengan berbagai keunggulan yang ada merupakan suatu keuntungan bagi konsumen. Konsumen dapat memilih sesuai dengan kriteria yang diinginkannya. Criteria ini menjadi pendorong utama mereka dalam kepuasan pembelian kendaraan bermotor roda dua. Beberapa jenis kendaraan roda dua dengan berbagai spesifikasi menawarkan kemudahaan dan keunggulan, mulai dari pembelian hingga perawatan. Masing-masing agen dan dealer berlomba merebut pasar yang ada.
    Untuk lebih jelasnya penjualan kendaraan bermotor roda dua merek Honda di Kota Jambi dapat dilihat pada tabel berikut ini :

    Tabel 1.1 Total Penjualan Kendaraan Bermotor Roda Dua Merek Honda di Kota Jambi Tahun
    2001-2005
    Tahun Total penjualan Honda (Unit) Pangsa Pasar
    2001 23.657 18.668 78,91
    2002 24.324 19.325 79,44
    2003 28.030 20.731 73,96
    2004 30.246 21.009 69,46
    2005 35.650 24.938 69,95
    Rata-rata 74,34
    Sumber : PD. Sinar Sentosa

    Tabel 1.1 di atas menunjukkan bahwa selama tahun 2001-2005 pangsa pasar kendaraan bermotor roda dua merek Honda di Kota Jambi rata-rata sebesar 74,34 persen. Hal ini menunjukkan bahwa kendaraan bermotor roda dua merek Honda menguasai sebagian besar penjualan kendaraan bermotor roda dua di Kota Jambi. Namun demikian, menilik perkembangan data pangsa pasar di atas terlihat terjadinya penurunannya penjualan pada tahun 2003 yakni sebesar 73,96 persen, dan terus mengalami penurunannya di bawah 70 persen pada tahun 2004 dan 2005. Hal ini sebagai cerminan semakin ketatnya persaingan dalam merebut pangsa pasar kendaraan bermotor, khusunya di Kota Jambi.
    Pada dasarnya tujuan suatu bisnis adalah untuk menciptakan pelanggan yang merasa puas. Terciptanya kepuasan akan memberikan dampak diantaranya hubungan yang baik antara perusahaan dan dan konsumen, memberikan dasar yang baik bagi pembelian ulang dan loyalitas pelanggan dan membentuk suatu rekomendasi dari mulut ke mulut yang menguntungkan perusahaan.
    Berdasarkan uraian di atas, terlihat bahwa kepuasan konsumen dalam pembelian produk motor merek Honda mempengaruhi perilaku untuk mengkonsumsinya. Oleh karena itu peneliti tertarik untuk mengetahui gambaran kepuasan konsumen dalam melakukan pembelian motor merek Honda secara lebih lanjut dalam bentuk skripsi dengan judul :
    “ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI’’.

    1.2 Perumusan Masalah
    Kendaraan bermotor merk Honda selama periode 2001-2005 menguasai pangsa pasar kendaraan bermotor roda dua lebih dari 74,34 persen.keberhasilan ini tidakterlepas dari kepuasan konsumen dalam memperoleh pelayanan kepuasan konsumen. Namun demin demikian dengan penurunan penguasaan pangsa pasar selama dua tahun terakhir dibawah 70% mengidikasikan semakin ketatnya persaingan penjualan kendaraan bermotor roda dua merk Honda.
    Dariuraian diatas maka masalah yang akan diteliti adalah sebagaiberikut:
    “ Bagaimana tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi?’’

    1.3 Tujuan Penelitian dan Manfaat Penulisan
    1.3.1 Tujuan Penelitian
    adapun tujuan penelitian ini adalah :
    1. Untuk mengukur tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.
    2. Untuk menganalisis tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.

    1.3.2 Manfaat Penelitian
    Adapun manfaat penelitian ini adalah :
    1. Secara akdemis hasil penelitian ini diharapkan menjadi salah satu referensi bagi penelitian-penelitian selanjutnya untuk menguji topic yang sama dengan penelitian ini.
    2. Secara praktis hasil penelitian ini diharapkan menjadi sumbangan pemikiran bagi agen tunggal pemegang merek, khususnya Honda dalam memperluas pasar.

    BAB II
    TINJAUAN PUSTAKA
    2.1 Definisi-Definisi
    Menurut William.J. Stanton (1997, hal 7) Pemasaran adalah suatu system total dari kegiatan bisnis yang direncanakan untuk menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan baik kepada konsumen saat ini maupun konsumen potensial.
    Menurut P. Kothler (1994, hal 4) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan konsep, penetapan harga, promosi dan distribusi barang dan jasa untuk menghasilkan pertukaran yang memenuhi sasaran perorangan dan organisasi.

    Komentar oleh M.ZUHDI AZWAR | Januari 11, 2012 | Balas

    • SELAMAT SIANG PAK JO
      PAK MOHON KOMENTAR DARI BAPAK TRIMAKASIH

      Komentar oleh MUHAMMAD ZUHDI AZWAR | Januari 23, 2012 | Balas

      • NAMA : M.ZUHDI AZWAR
        NIM : C1B008054
        TUGAS PROPOSAL SKRIPSI MEP

        ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI

        BAB1
        PENDAHULUAN

        1.1 Latar Belakang Penelitian
        Persaingan produk yang semakin ketat yang ditandai dengan munculnya persaingan untuk produk sejenis dengan berbagai kemudahan dan tingkat harga yang relatif lebih rendah, mendorong setiap perusahaan untuk lebih meningkatkan image terhadap produk yang ditawarkannya. Karena persaingan yang ada akan membuat konsumen semakin banyak pilihan dengan berbagai merek dalam melaksanakan keputusan pembelian dengan harga yang bervariasi di pasaran yang tersebar di berbagai daerah. Dalam kondisi yang demikian, perusahaan tidak dapat hanya memusatkan perhatiannya pada produk yang ditawarkan tetapi juga membuat strategi yang tepat agar produk yang dihasilkan dapat menarik perhatian konsumen dari berbagai macam produk yang ditawarkan oleh pesaing lainnya.
        Banyaknya jenis kendaraan bermotor roda dua yang ditawarkan pada saat ini dengan berbagai keunggulan yang ada merupakan suatu keuntungan bagi konsumen. Konsumen dapat memilih sesuai dengan kriteria yang diinginkannya. Criteria ini menjadi pendorong utama mereka dalam kepuasan pembelian kendaraan bermotor roda dua. Beberapa jenis kendaraan roda dua dengan berbagai spesifikasi menawarkan kemudahaan dan keunggulan, mulai dari pembelian hingga perawatan. Masing-masing agen dan dealer berlomba merebut pasar yang ada.
        Untuk lebih jelasnya penjualan kendaraan bermotor roda dua merek Honda di Kota Jambi dapat dilihat pada tabel berikut ini :

        Tabel 1.1 Total Penjualan Kendaraan Bermotor Roda Dua Merek Honda di Kota Jambi Tahun
        2001-2005
        Tahun Total penjualan Honda (Unit) Pangsa Pasar
        2001 23.657 18.668 78,91
        2002 24.324 19.325 79,44
        2003 28.030 20.731 73,96
        2004 30.246 21.009 69,46
        2005 35.650 24.938 69,95
        Rata-rata 74,34
        Sumber : PD. Sinar Sentosa

        Tabel 1.1 di atas menunjukkan bahwa selama tahun 2001-2005 pangsa pasar kendaraan bermotor roda dua merek Honda di Kota Jambi rata-rata sebesar 74,34 persen. Hal ini menunjukkan bahwa kendaraan bermotor roda dua merek Honda menguasai sebagian besar penjualan kendaraan bermotor roda dua di Kota Jambi. Namun demikian, menilik perkembangan data pangsa pasar di atas terlihat terjadinya penurunannya penjualan pada tahun 2003 yakni sebesar 73,96 persen, dan terus mengalami penurunannya di bawah 70 persen pada tahun 2004 dan 2005. Hal ini sebagai cerminan semakin ketatnya persaingan dalam merebut pangsa pasar kendaraan bermotor, khusunya di Kota Jambi.
        Pada dasarnya tujuan suatu bisnis adalah untuk menciptakan pelanggan yang merasa puas. Terciptanya kepuasan akan memberikan dampak diantaranya hubungan yang baik antara perusahaan dan dan konsumen, memberikan dasar yang baik bagi pembelian ulang dan loyalitas pelanggan dan membentuk suatu rekomendasi dari mulut ke mulut yang menguntungkan perusahaan.
        Berdasarkan uraian di atas, terlihat bahwa kepuasan konsumen dalam pembelian produk motor merek Honda mempengaruhi perilaku untuk mengkonsumsinya. Oleh karena itu peneliti tertarik untuk mengetahui gambaran kepuasan konsumen dalam melakukan pembelian motor merek Honda secara lebih lanjut dalam bentuk skripsi dengan judul :
        “ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI’’.

        1.2 Perumusan Masalah
        Kendaraan bermotor merk Honda selama periode 2001-2005 menguasai pangsa pasar kendaraan bermotor roda dua lebih dari 74,34 persen.keberhasilan ini tidakterlepas dari kepuasan konsumen dalam memperoleh pelayanan kepuasan konsumen. Namun demin demikian dengan penurunan penguasaan pangsa pasar selama dua tahun terakhir dibawah 70% mengidikasikan semakin ketatnya persaingan penjualan kendaraan bermotor roda dua merk Honda.
        Dariuraian diatas maka masalah yang akan diteliti adalah sebagaiberikut:
        “ Bagaimana tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi?’’

        1.3 Tujuan Penelitian dan Manfaat Penulisan
        1.3.1 Tujuan Penelitian
        adapun tujuan penelitian ini adalah :
        1. Untuk mengukur tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.
        2. Untuk menganalisis tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.

        1.3.2 Manfaat Penelitian
        Adapun manfaat penelitian ini adalah :
        1. Secara akdemis hasil penelitian ini diharapkan menjadi salah satu referensi bagi penelitian-penelitian selanjutnya untuk menguji topic yang sama dengan penelitian ini.
        2. Secara praktis hasil penelitian ini diharapkan menjadi sumbangan pemikiran bagi agen tunggal pemegang merek, khususnya Honda dalam memperluas pasar.

        BAB II
        TINJAUAN PUSTAKA
        2.1 Definisi-Definisi
        Menurut William.J. Stanton (1997, hal 7) Pemasaran adalah suatu system total dari kegiatan bisnis yang direncanakan untuk menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan baik kepada konsumen saat ini maupun konsumen potensial.
        Menurut P. Kothler (1994, hal 4) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan konsep, penetapan harga, promosi dan distribusi barang dan jasa untuk menghasilkan pertukaran yang memenuhi sasaran perorangan dan organisasi.
        Berdasarkan definisi di atas, maka dapat diketahui bahwa proses dan kegiatan pemasaran sebenarnya terjadi dan dimulai sejak sebelum barang diproduksi. Setiap keputusan dalam pemasaran harus dibuat untuk menentukan produk dan pasarnya, harga, promosi dan saluran distribusinya. Dengan kata lain pada saat produsen menetapkan barang apa yang akan diproduksi, siapa calon konsumennya, berapa harga keuntungan yang diharapkan, bagaimana mempromosikan dan mendistribusikannya sehingga bisa sampai ketangan konsumen, maka semua itu adalah termasuk dalam kegiatan dan proses pemasaran.
        Menurut Swasta (1995 : 89) strategi adalah rancangan besar yang menggambarkan bagaimana sebuah perusahaan harus beroperasi untuk mencapai tujuannya.
        Menurut tim penyusun kamus pusat Pembinaan dan Pengembangan Bahasa (1989 : 365) pelayanan adalah kemudahan yang diberikan sehubungan dengan jual beli barang dan jasa. Sedangkan meurut Nitisemito (1991 : 126) pelayanan merupakan salah satu kegiatan dalam bidang marketing yang bertujuan untuk meningkatkan omset penjualan dengan jalan mempengaruhi konsumen baik secara langsung maupun tidak langsung agar pelayanan memberikan kepuasan terhadap konsumen.
        Nitisemito (1997 : 233) memberikan pengertian kepuasan yaitu sebagai tingkat perasaan seseorang seelah membandingkan kinerja/hasil yang dirasakannya dengan harapannya.
        Menurut ISO 8402 (1997 : 124) konsumen adalah penerima barang atau jasa. Seorang konsumen dapat berupa pemakai, pengguna, ahli waris atau pembeli.

        2.2 Kerangka Teoritis
        Memahami masalah kepuasan akan berkaitan dengan sikap. Sikap merupakan bagian hakiki dari kepribadian seseorang. Sejumlah teori berusaha menerangkan pembentukan dan perubahan sikap. Salah sau teori tersebut mengemukakan bahwa orang “mencari kesesuaian antara kepercayaan dan perasaan mereka terhadap obyek”, dan menyarankan bahwa perubahan sikap tergantung dari salah satu perasaan atau kepercayaan.
        Komponen perilaku dari sikap berhubungan dengan kecenderungan seseorang untuk bertindak menghadapi sesuatu dengan cara tertentu. Jadi komponen perilaku adalah komponen tindakan dari kecakapan. Cara seseorang bertindak menghadapi orang lain atau sesuatu barang dapat ramah, hangat, agresif, bermusuhan, apatis atau dengan sesuatu cara lain. Tindakan ini dapat diukur atau dinilai untuk memeriksa komponen perilaku dari kecakapan.
        Perilaku konsumen yang baik dipengaruhi oleh faktor lingkungan perlu diprediksi untuk mengembangkan strategi pemasaran secara tepat. Kerangka konseptual untuk menganalisis perilaku konsumen mencakup kaitannya antara aspek-aspek cognition dan effective, lingkungan, perilaku dan strategi pemasaran.
        Menurut Swastha (1993 : 29) perilaku belanja konsumen atau disebut perilaku konsumen bukanlah suatu perkara kecil karena setiap anggota masyarakat merupakan konsumen. Konsumen dapat dikembangkan dan dipertahankan melalui strategi pemasaran. Dengan kata lain, keberhasilan suatu bisnis tergantung pada kualitas strategi pemasarannya, dan kualitas strategi pemasaran tergantung pada pemahaman pelayanan dan cara mempengaruhi konsumen untuk mencapai tujuan organisasi.
        Dalam pengertian diatas terdapat paling sedikit ada tiga hal penting yaitu :
        1. Perilaku konsumen bersifat dinamis.
        2. Perilaku konsumen itu melibatkan interaksi antara perasaan dan kesadaran perilaku.
        3. Perilaku konsumen melibatkan pertukaran.
        Dalam meningkatkan kepuasan konsumen melalui pelayanan yang bermutu, perusahaan terutama pelayanan harus mengetahui 4 (empat) kebutuhan dasar kepuasan pelanggan yaitu :

        1. Kebutuhan untuk dimengerti
        Orang yang memilih pelayanan suatu perusahaan merasa bahwa mereka berkomunikasi secara aktif. Ini berarti pesan yang mereka kirim harus ditafsirkan secara benar.
        2. Kebutuhan untuk merasa disambut dengan baik
        Siapa saja yang mengadakan bisnis dengan perusahaan dan merasa seperti orang luar, pasti tidak akan kembali. Orang perlu merasa bahwa perusahaan senang menemui mereka dan bahwa bisnis mrereka penting bagi perusahaan.
        3. Kebutuhan untuk merasa penting
        Ego dan harga diri adalah kebutuhan manusia terkuat. Kita semua perlu mengetahui apa saja yang dapat perusahaan lakukan untuk membuat konsumen merasa istimewa adalah salah sau langkah yang paling benar.
        4. Kebutuhan akan kenyamanan
        Konsumen memerlukan kenyamanan fisik, tempat untuk menunggu, beristirahat, berbicara atau mengadakan bisnis. Konsumen juga memerlukan kenyamanan dan psikologis, kepastian bahwa dilayani secara semstinya, dan kepercayaan bahwa perusahaan akan memenuhi kebutuhan konsumen.

        Peningkatan kepuasan konsumen telah menjadi hal yang sangat esensial bagi setiap perusahaan. Hal ini dikarenakan langkah tersebut dapat memberikan umpan balik dan masukan bagi keperluan pengembangan dan implementasi strategi peningkaan kepuasan konsumen.

        Zuhdi judul seperti ini sudah banyak, ap ayg membedakan ini dg yg pernah ditulis oleh temanmu terdahulu?

        Komentar oleh MUHAMMAD ZUHDI AZWAR | Januari 23, 2012

  109. Nama :Ayu pratiiwi
    Nim :C1B008055
    TUGAS PROPOSAL SKRIPSI MEP

    ANALISIS PERILAKU KONSUMEN DALAM MEMUTUSKAN MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD.
    BAB 1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian

    Pada dasarnya produk Mie Instan diketahui adalah salah satu produk makanan cepat saji yang semakin lama semakin banyak digemari oleh masyarakat khalayak luas,karena proses pembuatannya yang mudah membuat masyarakat tidak perlu susah payah membuatnya. Produk ini pun biasa dikonsumsi dengan harga yang relative terjangkau,mudah didapatkan dan sifatnya tahan lama.
    Produk ini pun bisa dibeli dari kalangan bawah sampai menengah atas, dan produk yang dikeluarkan mie instan ini pun tentunya beragam. Dari segi kemasan serta peningkatan kualitasnya pun masih berbeda. Dengan semakin banyaknya merek mie instan yang ada di pasaran berarti memberikan keleluasan bagi konsumen untuk memilih merek yang sesuai dengan keinginannya. Oleh karena itu sangat perlu bagi perusahaan untuk menganalisis perilaku konsumen untuk mengetahui pola pembeliannya. Dengan banyaknya merek mie instan yang ada dipasaran akan mendorong perusahaan bersaing mendapatkan calon konsumen melalui berbagai stategi yang tepat. Misalnya mengubah kemasan yang menarik, aroma, warna, promosi dan harga.
    Minat beli adalah kecenderungan responden untuk bertindak sebelum keputusan benar-benar membeli dilaksanakan. Terdapat perbedaan antara pembelian aktual dan minat pembelian ulang. Bila pembelian aktual adalah pembelian yang benar-benar dilakukan oleh konsumen. Maka minat pembelian ulang adalah niat untuk melakukan pembelian kembali kepada kesempatan mendatang.
    Keinginan untuk membeli merupakan tendensi konsumen untuk membeli suatu produk. Pengukuran keinginan untuk membeli tersebut merupakan suatu hal yang penting dalam pengembangan strategi. Selain itu perlu diperhatikan bahwa keputusan untuk membeli suatu produk dipengaruhi oleh dua hal yaitu sikap dan pendirian orang lain dan faktor situasi yang tidak diantisipasi. Sampai dimana pengaruh orang tersebut terdapat memutuskan minat beli konsumen ditentukan oleh intensitas dari pendirian negatif orang lain terhadap alternatif yang disuka konsumen dan motivasi konsumen untuk menuruti orang lain. Sedangkan pengaruh faktor situasi yang diantisipasi terhadap minat beli konsumen didasarkan pada faktor seperti pendapatan keluarga yang diharapkan, dan melihat produk yang diharapkan. Produsen pun harus lebih jauh lagi dalam mendistribusikan produknya kepasar konsumen berusaha agar produknya dapat diterima dengan sesuai apa yang diinginkan oleh konsumen.
    Tabel 1.1 berikut memperlihatkan berbagai macam variasi, harga dan rasa dari mie instan merek Indofood antara lain :

    Tabel 1.1
    Daftar Harga dan Variasi Mie instan Pada
    Merek Indofood
    No Nama Produk Harga Persatuan Harga Per Dus
    1 Indomie Kuah Kari Rp 1.400 Rp 48.272
    2 Indomie Kuah Ayam Bawang Rp 1.400 Rp.48.272
    3 Indomie Goreng Rp 1.500 Rp 49.500
    Sumber : PT.Indomaret

    Tabel 1.1 diatas menunjukkan adanya perbedaan harga dan variasi dari mie instan pada merek Indofood. Perlu diketahui mie instan yang pangsa pasarnya selama ini dikuasai oleh PT.Indofood, kini pangsa pasarnya semakin kecil dengan masuknya banyak pendatang baru mie instan.
    Oleh karena itu menjadi menarik untuk melakukan penelitian mengenai kebijaksanaan tersebut dan melaporkan hasilnya dalam bentuk skripsi dengan judul “ANALISIS PERILAKU KONSUMEN DALAM MEMUTUSKAN MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD’’.

    1.2 Perumusan Masalah
    “ Bagaimana tingkat kepuasan konsumen dalam memutuskan membeli produk mie instan merek Indofood ’’

    1.3 Tujuan Penelitian dan Manfaat Penelitian
    1.3.1 Tujuan Penelitian
    Penelitian ini bertujuan :
    1. Untuk memperoleh tingkat kepuasan konsumen dalam memutuskan pembelian produk mie instan merek Indofood.
    2. Untuk menganalisis perilaku konsumen dalam memutuskan membeli produk mie instan merek Indofood.
    1.3.2 Manfaat Penelitian

    Manfaat yang diharapkan dari adanya penelitian ini adalah :
    1. Hasil penelitian menjadi bahan penulisan skripsi yang merupakan salah satu syarat memperoleh gelar sarjana ekonomi.
    2. Hasil penelitian ini dapat menjadi masukan bagi PT.Indofood Jambi dimasa yang akan datang dalam usahanya untuk meningkatkan kinerja penjualannya.
    3. Dapat menjadi referensi bagi orang-orang yang berminat terhadap topik ini.

    BAB II

    TINJAUAN PUSTAKA

    2.1 Definisi-definisi
    Untuk memperjelas penulisan ini, maka perlu kiranya dikemukakan berupa pengertian :
    1. Manajemen
    Menurut Terry dan Rue (2001, hal 1) Manajemen adalah suatu proses atau kerangka kerja yang melibatkan bimbingan atau pengarahan suatu kelompok orang-orang ke arah tujuan-tujuan organisasional atau maksud-maksud yang nyata.
    2. Pemasaran
    Menurut Kotler (2002, hal 9) pemasaran adalah suatu proses sosial yang di dalamnya individu atau kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan dan secara bebas mempertukarkan produk yang bernilai dengan pihak lain.

    3. Manajemen Pemasaran
    Menurut Kotler (2002, hal 9) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan pemikiran, penetapan harga, promosi serta penyaluran gagasan, barang dan jasa untuk menciptakan pertukaran yang memenuhi sasaran-sasaran individu dan organisasi.
    4. Produk
    Menurut Angipora (2002, hal 4) Produk adalah sesuatu yang dapat ditawarkan pada suatu pasar untuk mendapatkan perhatian untuk dimiliki, penggunaan ataupun konsumsi yang bisa memuaskan keinginan ataupun kebutuhan.
    5. Promosi
    6. Keputusan Pembeli

    Pratiwi, konsep pembelian kenapa berganti dg kepuasan pelanggan? PErbaiki judul dan rumusan masalah.

    Komentar oleh Ayu Pratiwi | Januari 11, 2012 | Balas

    • pak kalau saya ganti jadi analisis kepuasan konsumen dalam memutuskan membeli produk mie instan merek indofood.

      Komentar oleh ayu pratiwi | Januari 19, 2012 | Balas

      • bapak kalau boleh saya mw ganti judlnya pak.
        judul saya :

        Nama : Ayu Pratiwi
        Nim : C1B008055
        Tugas Proposal Skripsi

        FAKTOR-FAKTOR YANG MEMPENGARUHI RESPON KONSUMEN DALAM MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD
        BAB 1
        PENDAHULUAN

        1.1 Latar Belakang Penelitian
        Kesadaran masyarakat untuk mengkonsumsi makanan yang bergizi dan bervariasi saat ini sudah semakin meningkat. Hal ini terlihat semakin banyaknya produk-produk makanan yang dijual di pusat-pusat penjualan produk makanan. Kesadaran ini dipengaruhi oleh semakin majunya teknologi informasi di bidang pangan, sehingga masyarakat atau konsumen lebih ingin praktis segala perubahan yang ada. Perubahan-perubahan ini ternyata secara tidak langsung mengubah selera dan kebiasaan masyarakat akan produk pangan yang dikonsumsinya.
        Kebiasaan masyarakat dalam mengkonsumsi produk pangan ini juga dipengaruhi oleh gaya hidup masyarakat yang sudah semakin dinamis karena kesibukan pekerjaan yang semakin tinggi yang menyebabkan konsumen melakukan upaya-upaya secara praktis dalam kebutuhannya. Tingginya aktivitas konsumen yang didorong oleh semakin tingginya kebutuhan yang menyebabkan pola konsumsi pangan masyarakat berubah. Perubahan pola atau gaya hidup, juga menjadi faktor pemicu terhadap terjadinya perubahan pola konsumsi. Misalnya. Orang zaman sekarang semakin sibuk dengan jam kerja lebih panjang, mendorong mereka untuk memilih makanan yang penyajiannya lebih praktis tapi tetap beragam. Perkembangan konsumsi makanan mie instan yang berbasis gandum ini dari tahun ke tahun memperlihatkan tren yang positif dan semakin berkembang.
        Pada dasarnya produk mie instan diketahui adalah salah satu produk makanan cepat saji yang semakin lama semakin banyak digemari oleh masyarakat khalayak luas, karena proses pembuatannya yang mudah membuat masyarakat tidak perlu susah payah membuatnya. Produk ini pun biasa dikonsumsi dengan harga yang relative terjangkau, mudah didapatkan dan sifatnya tahan lama.
        Dengan semakin banyaknya mie instan yang ada di pasaran berarti memberikan keleluasan bagi konsumen untuk memilih merek yang sesuai dengan keinginannya. Dan banyaknya merek mie instan yang ada di pasaran akan mendorong perusahaan bersaing mendapatkan calon konsumen melalui berbagai strategi yang tepat. Misalnya, mengubah kemasan yang menarik, aroma, warna, promosi, dan harga.
        Pergeseran pola konsumsi msyarakat ini ternyata berdampak positif terhadap industri makanan instan, terutama industry mie instan. Salah satu produsen mie instan terbesar di Indonesia saat ini adalah Indofood. Perusahaan ini menguasai hampir 80% dari produksi mie instan di Indonesia. Tidak dapat dipungkiri, mie memang sudah menjadi bagian penting dalam pola makan rumah tangga, tidak hanya diperkotaan tetapi juga di pedesaan. Peran mie memang luas, tidak hanya sebagai pangan pokok, tetapi dapat pula berperan sebagai lauk pauk sehingga sering dijumpai masyarakat yang makan nasi dengan lauk mie goring atau mie kuah.
        Diversifikasi produk dilakukan para produsen dalam rangka menyesuaikan dengan keinginan pasar sehingga tidak mengherankan jika pasar domestik mudah ditemukan berbagai produk mie instan dengan berbagai ukuran dan cita rasa. Semakin banyaknya jenis maupun merek mie yang beredar di pasar, maka keberhasilan suatu perusahaan tidak hanya ditentukan oleh kualitas produk saja, tetapi sangat ditentukan kemampuan perusahaan untuk mengidentifikasi mengenai kebutuhan dan keinginan konsumen.
        PT. Indofood bergerak di bidang usaha industri pengolahan makanan yang hamper seluruh produknya menguasai pasar di Indonesia. Produk yang dihasilkan termasuk mie instan
        ( Indomie, Sarimi, Supermi, Cup Noodles, Pop Mie, Intermie, Sakura ). Indofood merupakan produsen mie instan terbesar dengan kapasitas produk 13 milyar bungkus pertahun.
        Perkembangan produk mie instan yang sudah dianggap sebagai makanan cepat saji dan bahkan sebagai makanan pokok, menyebabkan tingkat persaingan pada industri mie instan ini semakin tinggi. Tingkat persaingan yang tinggi ini dapat menyebabkan pergeseran loyalitas konsumen mie instan produk Indofood kepada mie instan produk yang lain. Kondisi ini mendorong perusahaan untuk senantiasa melakukan riset pemasaran yang dilakukan terhadap konsumen, sehingga dapat diketahui kebutuhan dan keinginan konsumen akan suatu produk mie. Tingginya pangsa pasar mie instan mengharuskan perusahaan-perusahaan yang ada untuk berhati-hati, sehingga perusahaan dituntut harus selalu mengevaluasi dan mematangkan strategi pemasaran yang dijalankannya.
        Keinginan untuk membeli merupakan tendensi konsumen untuk membeli suatu produk. Pengukuran keinginan untuk membeli tersebut merupakan suatu hal yang penting dalam pengembangan strategi. Selain itu perlu diperhatikan bahwa keputusan untuk membeli suatu produk dipengaruhi oleh dua hal yaitu sikap dan pendirian orang lain dan faktor situasi yang tidak diantisipasi. Sampai dimana pengaruh orang tersebut terdapat memutuskan minat beli konsumen ditentukan oleh intensitas dari pendirian negative orang lain terhadap alternative yang disukai konsumen. Sedangkan pengaruh faktor situasi yang diantisipasi terhadap minat beli konsumen didasarkan pada faktor seperti pendapatan keluarga yang diharapkan dan melihat produk yang diharapkan. Produsen pun harus lebih jauh lagi dalam mendistribusikan produknya kepasar konsumen berusaha agar produknya dapat diterima dengan sesuai apa yang diinginkan konsumen.
        Tingkat persaingan yang tinggi ini dapat menyebabkan pergeseran loyalitas konsumen mie instan produk indofood kepada mie instan produk yang lain. Kondisi ini mendorong perusahaan untuk senantiasa melakukan riset pemasaran yang dilakukan terhadap konsumen, sehingga dapat diketahui kebutuhan dan keinginan konsumen akan suatu produk mie. Tingginya pangsa pasar mie instan mengharuskan perusahaan-perusahaan yang ada untuk berhati-hati, sehingga perusahaan dituntut harus selalu mengevaluasi dan mematangkan strategi pemasaran yang dijalankan.
        Perusahaan ingin mengetahui bagaimana proses keputusan pembelian mie instan, agar menghasilkan analisis pemasaran yang cermat sehingga perusahaan tidak dirugikan karena terjadinya kekeliruan dalam melakukan kegiatan pemasaran. Oleh karena itu, perlu diketahui respon konsumen terhadap produk mie instan tersebut. Untuk dapat menentukan respon konsumen, terlebih dahulu perlu diidentifikasikan faktor-faktor dalam proses respon konsumen dalam membeli produk tersebut. Mengetahui faktor-faktor tersebut akan memudahkan perusahaan dalam mengambil langkah dalam kegiatan pemasaran yang akan dilakukan sehingga dapat diketahui tingkat kepuasan dari konsumen mie instan merek indofood terhadap kegiatan pemasaran yang telah dilakukan perusahaan

        Konsumsi Indomie secara terus menerus tidak dianjurkan. Indomie mengandung pewarna tartrazine yang tidak baik dikonsumsi untuk jangka panjang. Indomie selain dapat dibeli perbungkus, dapat juga dibeli dengan paket 1 kardus berisi 30 atau 40 indomie. Harga indomie juga realatif sangat murah. Satu bungkus Indomie standar memiliki massa 85 gram, dan terdapat 2 sachet berisi 5 bumbu-bumbuan yang disertai yaitu kecap manis, saus sambal, minyak palm, bumbu perasa dan bawang goreng. Indomie juga tersedia dalam versi jumbo dengan massa 120 gram khusus Indomie Mi Goreng Spesial dan Rasa Panggang.
        Tabel 1.1 berikut memperlihatkan berbagai macam jenis-jenis dari produk mie instan merek Indofood antara lain :

        Tabel 1.1
        Jenis-jenis Dari Produk Mie Instan
        Merek Indofood

        Indomie Variasi Rasa
        1 Indomie Reguler Goreng Spesial plus, spesial kriuk bawang, kriuk ayam, pedas, rasa ayam, dan sate.
        2 Indomie Reguler Soap Sop ayam, kaldu udang, ayam spesial, kari ayam, bakso sapi, soto spesial, kaldu ayam, ayam bawang, soto mie.
        3 Indomie Regional Empal gentong, soto betawi, mie goreng cakalang, kari ayam medan, sop buntut, mie celor.
        4 Indomie Premium Mie kriting ayam, mie ayam, mie kriting ayam rasa ayam panggang dan mie kriting ayam goreng spesial
        5 Indomie Jumbo Mie goreng dan mie goreng rasa ayam panggang.
        Sumber : PT Indofood Sukses Makmur Tbk

        Tabel 1.1 diatas menunjukkan adanya perbedaan harga dan variasi dari mie instan pada merek Indofood dengan cita rasa yang berbeda.
        Oleh karena itu menjadi menarik untuk melakukan penelitian mengenai kebijaksanaan tersebut dan melaporkan hasilnya dalam bentuk skripsi dengan judul “FAKTOR-FAKTOR YANG MEMPENGARUHI RESPON KONSUMEN DALAM MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD ‘’.

        1.2 Perumusan Masalah
        Berdasarkan uraian diatas, permasalahan yang timbul akan dianalisis dalam penelitian ini adalah “ faktor-faktor apa saja yang mempengaruhi respon konsumen terhadap produk mie instan merek Indofood “

        1.3 Tujuan Penelitian dan Manfaat Penelitian
        1.3.1 Tujuan Penelitian
        Penelitian ini bertujuan :
        Bertujuan untuk mengetahui faktor-faktor apa saja yang dapat mempengaruhi respon konsumen terhadap produk Mie Instan merek Indofood.

        1.3.2 Manfaat Penelitian

        Manfaat yang diharapkan dari adanya penelitian ini adalah :
        1. Hasil penelitian menjadi bahan penulisan skripsi yang merupakan salah satu syarat memperoleh gelar sarjana ekonomi.
        2. Hasil penelitian ini dapat menjadi masukan bagi PT.Indofood Jambi dimasa yang akan datang dalam usahanya untuk meningkatkan kinerja penjualannya.
        3. Dapat menjadi referensi bagi orang-orang yang berminat terhadap topik ini.

        BAB II

        TINJAUAN PUSTAKA

        2.1 Definisi – Definisi
        Sehubungan dengan permasalahan yang terdapat dalam penelitian ini maka diperlukan adanya teori-teori atau konsep-konsep yang memerlukan penjelasan. Dalam benak perusahaan, pemasaran memegang peranan sebagai suatu faktor penting untuk tetap bertahan menjalankan usaha dan bergelut dalam dunia persaingan. Pemasaran merupakan faktor vital sebagai strategi perusahaan dalam menjalankan usahanya, yang terutama berhubungan dengan konsumen.
        1. Manajemen
        Menurut Terry dan Rue (2001, hal 1) Manajemen adalah suatu proses atau kerangka kerja yang melibatkan bimbingan atau pengarahan suatu kelompok orang-orang ke arah tujuan-tujuan organisasional atau maksud-maksud yang nyata.

        2. Pemasaran
        Menurut Kotler (2002, hal 9) pemasaran adalah suatu proses sosial yang di dalamnya individu atau kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan dan secara bebas mempertukarkan produk yang bernilai dengan pihak lain.
        3. Manajemen Pemasaran
        Menurut Kotler (2002, hal 9) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan pemikiran, penetapan harga, promosi serta penyaluran gagasan, barang dan jasa untuk menciptakan pertukaran yang memenuhi sasaran-sasaran individu dan organisasi
        4. Produk
        Menurut Angipora (2002, hal 4) Produk adalah sesuatu yang dapat ditawarkan pada suatu pasar untuk mendapatkan perhatian untuk dimiliki, penggunaan ataupun konsumsi yang bisa memuaskan keinginan ataupun kebutuhan.
        5. Perilaku Konsumen
        Menurut Swasta (1992, hal 9) Perilaku Konsumen adalah ilmu yang mempelajari tingkah laku konsumen dalam arti tindakan-tindakan yang dilakukan untuk membeli suatu barang atau jasa tertentu.
        6. Faktor-Faktor Yang Mempengaruhi Perilaku Pembelian Konsumen.
        Menurut Kotler ( 2002, hal 183 ) Faktor-faktor yang mempengaruhi prilaku pembelian konsumen yaitu :

        Rumusan masalahmy belum menunjukkan fokus yg dapat diteliti, demikian juga daftar pustaka kurang lazim digunakan. Diperbaiki.

        Komentar oleh Ayu Pratiwi | Januari 21, 2012

  110. Nama :M zuhdi azwar
    Nim :C1B008054

    TUGAS PROPOSAL SKRIPSI MEP

    ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI

    BAB1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian
    Persaingan produk yang semakin ketat yang ditandai dengan munculnya persaingan untuk produk sejenis dengan berbagai kemudahan dan tingkat harga yang relatif lebih rendah, mendorong setiap perusahaan untuk lebih meningkatkan image terhadap produk yang ditawarkannya. Karena persaingan yang ada akan membuat konsumen semakin banyak pilihan dengan berbagai merek dalam melaksanakan keputusan pembelian dengan harga yang bervariasi di pasaran yang tersebar di berbagai daerah. Dalam kondisi yang demikian, perusahaan tidak dapat hanya memusatkan perhatiannya pada produk yang ditawarkan tetapi juga membuat strategi yang tepat agar produk yang dihasilkan dapat menarik perhatian konsumen dari berbagai macam produk yang ditawarkan oleh pesaing lainnya.
    Banyaknya jenis kendaraan bermotor roda dua yang ditawarkan pada saat ini dengan berbagai keunggulan yang ada merupakan suatu keuntungan bagi konsumen. Konsumen dapat memilih sesuai dengan kriteria yang diinginkannya. Criteria ini menjadi pendorong utama mereka dalam kepuasan pembelian kendaraan bermotor roda dua. Beberapa jenis kendaraan roda dua dengan berbagai spesifikasi menawarkan kemudahaan dan keunggulan, mulai dari pembelian hingga perawatan. Masing-masing agen dan dealer berlomba merebut pasar yang ada.
    Untuk lebih jelasnya penjualan kendaraan bermotor roda dua merek Honda di Kota Jambi dapat dilihat pada tabel berikut ini :

    Tabel 1.1 Total Penjualan Kendaraan Bermotor Roda Dua Merek Honda di Kota Jambi Tahun
    2001-2005
    Tahun Total penjualan Honda (Unit) Pangsa Pasar
    2001 23.657 18.668 78,91
    2002 24.324 19.325 79,44
    2003 28.030 20.731 73,96
    2004 30.246 21.009 69,46
    2005 35.650 24.938 69,95
    Rata-rata 74,34
    Sumber : PD. Sinar Sentosa

    Tabel 1.1 di atas menunjukkan bahwa selama tahun 2001-2005 pangsa pasar kendaraan bermotor roda dua merek Honda di Kota Jambi rata-rata sebesar 74,34 persen. Hal ini menunjukkan bahwa kendaraan bermotor roda dua merek Honda menguasai sebagian besar penjualan kendaraan bermotor roda dua di Kota Jambi. Namun demikian, menilik perkembangan data pangsa pasar di atas terlihat terjadinya penurunannya penjualan pada tahun 2003 yakni sebesar 73,96 persen, dan terus mengalami penurunannya di bawah 70 persen pada tahun 2004 dan 2005. Hal ini sebagai cerminan semakin ketatnya persaingan dalam merebut pangsa pasar kendaraan bermotor, khusunya di Kota Jambi.
    Pada dasarnya tujuan suatu bisnis adalah untuk menciptakan pelanggan yang merasa puas. Terciptanya kepuasan akan memberikan dampak diantaranya hubungan yang baik antara perusahaan dan dan konsumen, memberikan dasar yang baik bagi pembelian ulang dan loyalitas pelanggan dan membentuk suatu rekomendasi dari mulut ke mulut yang menguntungkan perusahaan.
    Berdasarkan uraian di atas, terlihat bahwa kepuasan konsumen dalam pembelian produk motor merek Honda mempengaruhi perilaku untuk mengkonsumsinya. Oleh karena itu peneliti tertarik untuk mengetahui gambaran kepuasan konsumen dalam melakukan pembelian motor merek Honda secara lebih lanjut dalam bentuk skripsi dengan judul :
    “ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI’’.

    1.2 Perumusan Masalah
    Kendaraan bermotor merk Honda selama periode 2001-2005 menguasai pangsa pasar kendaraan bermotor roda dua lebih dari 74,34 persen.keberhasilan ini tidakterlepas dari kepuasan konsumen dalam memperoleh pelayanan kepuasan konsumen. Namun demin demikian dengan penurunan penguasaan pangsa pasar selama dua tahun terakhir dibawah 70% mengidikasikan semakin ketatnya persaingan penjualan kendaraan bermotor roda dua merk Honda.
    Dariuraian diatas maka masalah yang akan diteliti adalah sebagaiberikut:
    “ Bagaimana tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi?’’

    1.3 Tujuan Penelitian dan Manfaat Penulisan
    1.3.1 Tujuan Penelitian
    adapun tujuan penelitian ini adalah :
    1. Untuk mengukur tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.
    2. Untuk menganalisis tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.

    1.3.2 Manfaat Penelitian
    Adapun manfaat penelitian ini adalah :
    1. Secara akdemis hasil penelitian ini diharapkan menjadi salah satu referensi bagi penelitian-penelitian selanjutnya untuk menguji topic yang sama dengan penelitian ini.
    2. Secara praktis hasil penelitian ini diharapkan menjadi sumbangan pemikiran bagi agen tunggal pemegang merek, khususnya Honda dalam memperluas pasar.

    BAB II
    TINJAUAN PUSTAKA
    2.1 Definisi-Definisi
    Menurut William.J. Stanton (1997, hal 7) Pemasaran adalah suatu system total dari kegiatan bisnis yang direncanakan untuk menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan baik kepada konsumen saat ini maupun konsumen potensial.
    Menurut P. Kothler (1994, hal 4) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan konsep, penetapan harga, promosi dan distribusi barang dan jasa untuk menghasilkan pertukaran yang memenuhi sasaran perorangan dan organisasi.

    Komentar oleh muhammad zuhdi azwar | Januari 11, 2012 | Balas

    • bapak mohon komentarnya ya pak.
      terima kasih pak

      Komentar oleh m.zuhdi azwar | Januari 21, 2012 | Balas

  111. Nama : Marhamah
    Nim : ERC1B009061
    Kelas : ekstensi

    Pak ini judul yang bapak saran kan kepada saya tentang
    “STRATEGI PENJUALAN MOBIL BEKAS PADA DEALER MEGA GEMILANG MOTOR“
    Bagaimana pak apakah saya boleh mengajukan proposal tentatifnya???

    Komentar oleh Marhamah | Januari 11, 2012 | Balas

    • maaf pak bagaimana apakah saya boleh melanjutkan proposal tentatif saya??
      atau saya perlu perbaiki lagi?
      saya punya judul satu lagi pak mengenai
      “ANALISIS STRATEGI PEMASARAN UNTUK MENINGKATKAN PENJUALAN KENDARAAN MOBIL PADA CV MEGA GEMILANG MOTOR”

      menurut bapak mana yg bagus tuk di lanjutkan?? mohon saran nya pak.. trima kasih :)

      Komentar oleh MARHAMAH | Januari 14, 2012 | Balas

  112. NAMA: YUDI ANDRIANSYAH PUTRA
    NIM: C1B009039
    TUGAS MEP

    JUDUL :Analisis Faktor-Faktor yang Mempengaruhi Perilaku Konsumen Dalam Membeli Komputer di jambi

    BAB I
    PENDAHULUAN

    1.1 Latar Belakang Masalah

    Perkembangan teknologi informasi dan globalisasi yang begitu pesat, berdampak semakin tingginya persaingan memperebutkan pangsa pasar pada dunia usaha saat ini. Perusahaan yang ingin berhasil dalam persaingan pada era millinium harus memiliki strategi perusahaan yang dapat memahami perilaku konsumen. Perusahaan yang baik adalah memahami betul siapa konsumennya dan bagaimana mereka berperilaku. Pemahaman mengenai siapa konsumennya akan menuntun para pengusaha kepada keberhasilan memenangkan persaingan dunia usaha yang telah melampaui batas negara. Dunia teknologi informasi memang selalu menarik untuk diamati, ini ditandai dengan perkembangan internet dan teknologi informasi seperti komputer yang begitu cepat dan canggih sehingga setiap orang tertarik untuk memiliki. Sekarang ini setiap orang tidak hanya memiliki suatu produk karena fungsinya saja, tetapi juga rasa bangga dan pengakuan yang didapatkan dari memiliki produk tersebut.Teknologi computer (PC Desktop dan Notebook ) merupakan salah bentuk produk yang inovasinya tiada henti yang dapat menarik perhatian konsumen untuk membeli. Dengan desain yang diimbangi dengan fitur-fitur/fasilitas yang disediakan disesuaikan dengan perkembangan kebutuhan konsumen merupakan daya tarik untuk mempengaruhi perilaku konsumen. Seperti yang dilakukan oleh perusahaan ACER yang memiliki keunggulan dalam haldesain dibandingkan dengan pesaing pesaingnya seperti HEWLET PACKARD, TOSHIBA, LENOVO,merek lain/Gabungan (NEC, SONY, APPLE, GATWAY ,dll).Persaingan yang sangat ketat dimana ACER meraih pangsa pasar komputer terbesar 30 % untuk pasar di Indonesia, kemudian
    Hewlet Packard (HP) dengan pangsa pasar 12 % dan merek lain seperti TOSHIBA, LENOVO, bersaing ketat rata-rata 10 persen sedangkan merek lain seperti NEC, APPLE, GATWAY, SONY,dan lain-lain masih jauh terlalu jauh bila dibandingkan dengan lain yang pangsa pasarnya sudah mencapai rata-ratadi atas 10 %.
    Semakin banyaknya pelaku usaha yang bergerak dalam bidang usaha yang sejenis yang beroperasi serta memproduksi dengan menawarkan berbagai macam produk/jasa yangditawarkan, membuat masyarakat sulit menentukan pilihan sesuai dengan kebutuhan mereka.Oleh sebab itu, para pelaku usaha berlomba untuk meningkatkan mutu produksi sehingga dapat menarik para konsumen untuk membeli hasil produk yang ditawarkan.Di lain pihak seperti halnya yang sudah disebutkan, apabila sebuah produk/jasa melebihi harapan konsumen, konsumen akan merasa puas dan akan melakukan pembelian ulang. Hal ini merupakan perilaku konsumen dimana suatu tindakan nyata bagi konsumen yang dipengaruhi oleh faktor-faktor kejiwaan dan faktor luar lainnya yang dapat mengarahkan mereka untuk memilih dan mempergunakan barang/jasa yang diinginkannya.Perilaku konsumen dapat dirumuskan sebagai perilaku yang ditunjukkan oleh orang-orang, dalam hal merencanakan, mempertimbangkan, membeli dan menggunakan barang-barang atau jasa-jasa yang ditawarkan oleh setiap pelaku usaha. Dengan demikian dapat disimpulkan perilaku konsumen terdiri dari aktifitas-aktifitas yang melibatkan orang-orang sewaktu sedang menyeleksi, mempertimbangkan, membeli dan menggunakan produk-produk dan jasa-jasa,sedemikian rupa sehingga hal tersebut dapat memberikan kepuasan bagi mereka sehinggaterpenuhi kebutuhan-kebutuhan dan keinginan-keinginan mereka.Minat beli setiap seseorang dapat ditingkatkan dengan memperhatikan beberapa faktor,antara lain faktor psikis yang merupakan faktor pendorong yang berasal dari dalam diri konsumen itu sendiri yaitu motivasi, persepsi, pengetahuan, keyakinan dan sikap, selain itu faktor sosial yang merupakan proses dimana perilaku seseorang di pengaruhi oleh keluarga, status sosial, dan kelompok acuan, kemudian pemberdayaan bauran pemasaran yang terdiri dari produk, harga, promosi dan juga distribusi. Perilaku konsumen pasca pembelian sangat penting bagi suatu perusahaan. Dengan demikian perilaku konsumen dapat mempengaruhi orang atau pihak lain dengan ucapan-ucapan mereka tentang suatu produk yang dihasilkan oleh suatu perusahaan.Bagi semua perusahaan, baik yang menjual produk maupun jasa, perilaku konsumen pasca pembelian, akan menentukan minat konsumen apakah mereka akan membeli lagi produk/jasa perusahaan yang ditawarkan tersebut. Ada kemungkinan konsumen tidak akan membeli produk/jasa perusahaan yang ditawarkan lagi setelah mereka merasakan ketidaksesuaian kualitas produk/jasa yang didapatkan dengan keinginan atau apa yang digambarkan sebelumnya.Di sini penulis membahas tentang produk komputer yaitu Personal Computer Desktop dan Notebook walau saat ini komputer bukan lagi barang yang langka, tapi masih saja banyak orang yang gamang dan bingung menentukan komputer yang ingin mereka miliki, baik itu Branded,Rakitan maupun Bekas.Untuk bisa mendapatkan komputer sesuai dengan yang kita butuhkan diperlukan perencanaan yang matang maka surveylah terlebih dahulu.
    Dari latar belakang yang dikemukakan maka penulis mencoba untuk melakukan penelitian dengan judul
    “Analisis Faktor-Faktor yang Mempengaruhi Perilaku Konsumen Dalam Membeli Komputer di Jambi”

    2. Rumusan Masalah
    1.Apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara parsial terhadap perilaku konsumen dalam pembelian komputer ?
    2.Apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara serempak terhadap perilaku konsumen dalam pembelian komputer ?
    3.Diantara faktor-faktor tersebut di atas, faktor mana yang paling dominan mempengaruhi konsumen dalam melakukan pembelian komputer.?

    3.Tujuan Penelitian

    1.Untuk mengkaji apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara parsial terhadap perilaku konsumen dalam membeli komputer.
    2Untuk mengkaji apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara serempak terhadap perilaku konsumen dalam membeli komputer
    3.Untuk mengetahui faktor mana yang paling dominan mempengaruhi konsumen dalam melakukan pembelian komputer.

    4.Manfaat Penelitian

    1.Sebagai sarana dan media untuk mengembangkan ilmu pengetahuan dan sebagai bahan literature untuk menambah wacana baru bagi dunia akademis.
    2.Sebagai sarana untuk memperoleh informasi yang tepat dan akurat dalammempengaruhi dan mengetahui pengambilan keputusan oleh konsumen yang dilihat dari perilaku konsumen.
    3.Sebagai bahan masukan bagi perusahaan dalam menentukan produk yang benar-benar sesuai dengan kebutuhan, keinginan dan selera konsumen..
    4.Untuk memperkaya khasanah penelitian yang ada serta dapat digunakan sebagai perbandingan penelitian berikutnya.

    BAB II
    METODELOGI PENELITIAN

    1.Sampel dan Populasi

    Populasi dalam penlitian ini adalah seluruh konsumen yang membeli/memiliki komputer di jambi.
    Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh populasi tersebut.Metode pengambilan sampel yang digunakan adalah non probality sampling . Teknik dengan type purposive sampling.
    Purposive sampling adalah metode penentuan sampel yang didasarkan pada ciri-ciri atau sifat-sifat tertentu yang dipandang mempunyai sangkut paut yang erat dengan ciri-ciri atau sifat-sifat populasi yang sudah diketahui sebelumnya. Maka, jumlah minimal sampel dalam penelitian ini yang harus dipenuhi sebanyak 60 sampel/responden. Dalam hal ini penulis menentukan jumlah responden sebanyak 150 responden. Alasanya karena pelanggan atau konsumen yang menggunakan komputer tergolong banyak jumlahnya, oleh sebab itu penulis memutuskan mengambil sampel/responden sebanyak 150 untuk mendapatkan data yang akurat.

    2. Jenis dan Sumber data

    2.1 Jenis
    Jenis data yang digunakan dalam penelitian terdiri data kualitatif yang diperoleh dari hasil pengamatan dan data kuantitatif yang diperoleh dari penyebaran kuesioner responden

    2.2 Sumber Data
    1.Data primer yaitu data yang diperoleh melalui penelitian dilapangan baik melalui responden maupun hasil pengamatan.
    2.Data sekunder yaitu data yang diperoleh dari hasil bacaan dari buku-buku, majalah,makalah dan dokumen-dokumen yang dijadikan objek studi.
    3. Teknik Pengumpulan Data
    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    1.Menyebarkan kuesioner Mengajukan sejumlah pertanyaan kepada responden yang akan dijawab dalam bentuk tulisan sesuai dengan pertanyaan.
    2.WawancaraMengumpulan data dari informan yang berhubungan dengan objek penelitian.
    4. Variabel PenelitianVariabel yang akan digunakan dalam penelitian ini
    adalah:
    1. Variabel terikat (y) ; perilaku konsumen dalam membeli komputer.
    2. Variabel bebas (x) : Merek, harga, desain, Kualitas, pelayanan.

    4. Definisi Operasional Variabel
    1.Merek (X1)Responden memperhatikan nama dagang dari produk suatu komputer
    2.Harga (X2)Responden memilih seberapa besar uang yang dikeluarkan untuk membeli komputer
    3.Desain (X3)Responden memperhatikan bentuk fisik,style
    dan fitur-fitur atau fasilitas yang terdapat pada kompter tersebut.
    4.Kualitas (X4)Responden memperhatikan ketahanan/umur dari produk (komputer) tersebut.
    5.Pelayanan (X5)Responden memperhatikan purnajual
    (service) dari produsen yang mengeluarkan produk (computer) baik itu pelayanan kerusakan maupun tersedianya suku cadang/komponen

    Yudi, kata Jambi mewakili provinsi dan Kota. Saran saya dari awal tentukan saja wilayahnya. Ini perlu untuk kemudahan memilih sampel. Kalau semua orang yg memilki komputer itu sesutu yg terlalu luas. Perbaiki lagi sampel dan populasi.

    Komentar oleh YUDI ANDRIANSYAH PUTRA | Januari 11, 2012 | Balas

  113. NAMA: YUDI ANDRIANSYAH PUTRA
    NIM: C1B009039
    TUGAS MEP
    JUDUL :Analisis Faktor-Faktor yang Mempengaruhi Perilaku Konsumen Dalam Membeli Komputer di jambi
    BAB I
    PENDAHULUAN
    1.1 Latar Belakang Masalah
    Perkembangan teknologi informasi dan globalisasi yang begitu pesat, berdampak semakin tingginya persaingan memperebutkan pangsa pasar pada dunia usaha saat ini. Perusahaan yang ingin berhasil dalam persaingan pada era millinium harus memiliki strategi perusahaan yang dapat memahami perilaku konsumen. Perusahaan yang baik adalah memahami betul siapa konsumennya dan bagaimana mereka berperilaku. Pemahaman mengenai siapa konsumennya akan menuntun para pengusaha kepada keberhasilan memenangkan persaingan dunia usaha yang telah melampaui batas negara. Dunia teknologi informasi memang selalu menarik untuk diamati, ini ditandai dengan perkembangan internet dan teknologi informasi seperti komputer yang begitu cepat dan canggih sehingga setiap orang tertarik untuk memiliki. Sekarang ini setiap orang tidak hanya memiliki suatu produk karena fungsinya saja, tetapi juga rasa bangga dan pengakuan yang didapatkan dari memiliki produk tersebut.Teknologi computer (PC Desktop dan Notebook ) merupakan salah bentuk produk yang inovasinya tiada henti yang dapat menarik perhatian konsumen untuk membeli. Dengan desain yang diimbangi dengan fitur-fitur/fasilitas yang disediakan disesuaikan dengan perkembangan kebutuhan konsumen merupakan daya tarik untuk mempengaruhi perilaku konsumen. Seperti yang dilakukan oleh perusahaan ACER yang memiliki keunggulan dalam haldesain dibandingkan dengan pesaing pesaingnya seperti HEWLET PACKARD, TOSHIBA, LENOVO,merek lain/Gabungan (NEC, SONY, APPLE, GATWAY ,dll).Persaingan yang sangat ketat dimana ACER meraih pangsa pasar komputer terbesar 30 % untuk pasar di Indonesia, kemudian
    Hewlet Packard (HP) dengan pangsa pasar 12 % dan merek lain seperti TOSHIBA, LENOVO, bersaing ketat rata-rata 10 persen sedangkan merek lain seperti NEC, APPLE, GATWAY, SONY,dan lain-lain masih jauh terlalu jauh bila dibandingkan dengan lain yang pangsa pasarnya sudah mencapai rata-ratadi atas 10 %.
    Semakin banyaknya pelaku usaha yang bergerak dalam bidang usaha yang sejenis yang beroperasi serta memproduksi dengan menawarkan berbagai macam produk/jasa yangditawarkan, membuat masyarakat sulit menentukan pilihan sesuai dengan kebutuhan mereka.Oleh sebab itu, para pelaku usaha berlomba untuk meningkatkan mutu produksi sehingga dapat menarik para konsumen untuk membeli hasil produk yang ditawarkan.Di lain pihak seperti halnya yang sudah disebutkan, apabila sebuah produk/jasa melebihi harapan konsumen, konsumen akan merasa puas dan akan melakukan pembelian ulang. Hal ini merupakan perilaku konsumen dimana suatu tindakan nyata bagi konsumen yang dipengaruhi oleh faktor-faktor kejiwaan dan faktor luar lainnya yang dapat mengarahkan mereka untuk memilih dan mempergunakan barang/jasa yang diinginkannya.Perilaku konsumen dapat dirumuskan sebagai perilaku yang ditunjukkan oleh orang-orang, dalam hal merencanakan, mempertimbangkan, membeli dan menggunakan barang-barang atau jasa-jasa yang ditawarkan oleh setiap pelaku usaha. Dengan demikian dapat disimpulkan perilaku konsumen terdiri dari aktifitas-aktifitas yang melibatkan orang-orang sewaktu sedang menyeleksi, mempertimbangkan, membeli dan menggunakan produk-produk dan jasa-jasa,sedemikian rupa sehingga hal tersebut dapat memberikan kepuasan bagi mereka sehinggaterpenuhi kebutuhan-kebutuhan dan keinginan-keinginan mereka.Minat beli setiap seseorang dapat ditingkatkan dengan memperhatikan beberapa faktor,antara lain faktor psikis yang merupakan faktor pendorong yang berasal dari dalam diri konsumen itu sendiri yaitu motivasi, persepsi, pengetahuan, keyakinan dan sikap, selain itu faktor sosial yang merupakan proses dimana perilaku seseorang di pengaruhi oleh keluarga, status sosial, dan kelompok acuan, kemudian pemberdayaan bauran pemasaran yang terdiri dari produk, harga, promosi dan juga distribusi. Perilaku konsumen pasca pembelian sangat penting bagi suatu perusahaan. Dengan demikian perilaku konsumen dapat mempengaruhi orang atau pihak lain dengan ucapan-ucapan mereka tentang suatu produk yang dihasilkan oleh suatu perusahaan.Bagi semua perusahaan, baik yang menjual produk maupun jasa, perilaku konsumen pasca pembelian, akan menentukan minat konsumen apakah mereka akan membeli lagi produk/jasa perusahaan yang ditawarkan tersebut. Ada kemungkinan konsumen tidak akan membeli produk/jasa perusahaan yang ditawarkan lagi setelah mereka merasakan ketidaksesuaian kualitas produk/jasa yang didapatkan dengan keinginan atau apa yang digambarkan sebelumnya.Di sini penulis membahas tentang produk komputer yaitu Personal Computer Desktop dan Notebook walau saat ini komputer bukan lagi barang yang langka, tapi masih saja banyak orang yang gamang dan bingung menentukan komputer yang ingin mereka miliki, baik itu Branded,Rakitan maupun Bekas.Untuk bisa mendapatkan komputer sesuai dengan yang kita butuhkan diperlukan perencanaan yang matang maka surveylah terlebih dahulu.
    Dari latar belakang yang dikemukakan maka penulis mencoba untuk melakukan penelitian dengan judul
    “Analisis Faktor-Faktor yang Mempengaruhi Perilaku Konsumen Dalam Membeli Komputer di Jambi”
    2. Rumusan Masalah
    1.Apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara parsial terhadap perilaku konsumen dalam pembelian komputer ?
    2.Apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara serempak terhadap perilaku konsumen dalam pembelian komputer ?
    3.Diantara faktor-faktor tersebut di atas, faktor mana yang paling dominan mempengaruhi konsumen dalam melakukan pembelian komputer.?
    3.Tujuan Penelitian
    1.Untuk mengkaji apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara parsial terhadap perilaku konsumen dalam membeli komputer.
    2Untuk mengkaji apakah faktor merek, harga, desain, kualitas dan pelayanan berpengaruh secara serempak terhadap perilaku konsumen dalam membeli komputer
    3.Untuk mengetahui faktor mana yang paling dominan mempengaruhi konsumen dalam melakukan pembelian komputer.
    4.Manfaat Penelitian
    1.Sebagai sarana dan media untuk mengembangkan ilmu pengetahuan dan sebagai bahan literature untuk menambah wacana baru bagi dunia akademis.
    2.Sebagai sarana untuk memperoleh informasi yang tepat dan akurat dalammempengaruhi dan mengetahui pengambilan keputusan oleh konsumen yang dilihat dari perilaku konsumen.
    3.Sebagai bahan masukan bagi perusahaan dalam menentukan produk yang benar-benar sesuai dengan kebutuhan, keinginan dan selera konsumen..
    4.Untuk memperkaya khasanah penelitian yang ada serta dapat digunakan sebagai perbandingan penelitian berikutnya.
    BAB II
    METODELOGI PENELITIAN
    1.Sampel dan Populasi
    Populasi dalam penlitian ini adalah seluruh konsumen yang membeli/memiliki komputer di jambi.
    Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh populasi tersebut.Metode pengambilan sampel yang digunakan adalah non probality sampling . Teknik dengan type purposive sampling.
    Purposive sampling adalah metode penentuan sampel yang didasarkan pada ciri-ciri atau sifat-sifat tertentu yang dipandang mempunyai sangkut paut yang erat dengan ciri-ciri atau sifat-sifat populasi yang sudah diketahui sebelumnya. Maka, jumlah minimal sampel dalam penelitian ini yang harus dipenuhi sebanyak 60 sampel/responden. Dalam hal ini penulis menentukan jumlah responden sebanyak 150 responden. Alasanya karena pelanggan atau konsumen yang menggunakan komputer tergolong banyak jumlahnya, oleh sebab itu penulis memutuskan mengambil sampel/responden sebanyak 150 untuk mendapatkan data yang akurat.
    2. Jenis dan Sumber data
    2.1 Jenis
    Jenis data yang digunakan dalam penelitian terdiri data kualitatif yang diperoleh dari hasil pengamatan dan data kuantitatif yang diperoleh dari penyebaran kuesioner responden
    2.2 Sumber Data
    1.Data primer yaitu data yang diperoleh melalui penelitian dilapangan baik melalui responden maupun hasil pengamatan.
    2.Data sekunder yaitu data yang diperoleh dari hasil bacaan dari buku-buku, majalah,makalah dan dokumen-dokumen yang dijadikan objek studi.
    3. Teknik Pengumpulan Data
    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    1.Menyebarkan kuesioner Mengajukan sejumlah pertanyaan kepada responden yang akan dijawab dalam bentuk tulisan sesuai dengan pertanyaan.
    2.WawancaraMengumpulan data dari informan yang berhubungan dengan objek penelitian.
    4. Variabel PenelitianVariabel yang akan digunakan dalam penelitian ini
    adalah:
    1. Variabel terikat (y) ; perilaku konsumen dalam membeli komputer.
    2. Variabel bebas (x) : Merek, harga, desain, Kualitas, pelayanan.
    4. Definisi Operasional Variabel
    1.Merek (X1)Responden memperhatikan nama dagang dari produk suatu komputer
    2.Harga (X2)Responden memilih seberapa besar uang yang dikeluarkan untuk membeli komputer
    3.Desain (X3)Responden memperhatikan bentuk fisik,style
    dan fitur-fitur atau fasilitas yang terdapat pada kompter tersebut.
    4.Kualitas (X4)Responden memperhatikan ketahanan/umur dari produk (komputer) tersebut.
    5.Pelayanan (X5)Responden memperhatikan purnajual
    (service) dari produsen yang mengeluarkan produk (computer) baik itu pelayanan kerusakan maupun tersedianya suku cadang/komponen

    Yudi, Dalam judulmu dikatakan Jambi. Ini bisa berkaitan dg Kota Jambi atau Provinsi Jambi. Kemudian dikatakan seluruh orang yg memilki komputer ini terlalu luas. Anda lebih baik memilih di satu wilayah saja atau di satu kalangan misalkan mahasiswa. Atau malah bisa dilakukan untuk penyelenggaran Kurusus komputer misalnya, karena mereka banyak menggunakankomputer. Silahkan diperjelas.

    Komentar oleh johannessimatupang | Januari 11, 2012 | Balas

  114. BAB I
    PENDAHULUAN

    1.1latar belakang
    Pemasaran merupakan salah satu aspek penting dalam menunjang keberhasilan bagi suatu perusahaan, dengan adanya persaingan yang semakin ketat akan mempengaruhi kelangsungan hidup perusahaan. Dalam kondisi yang demikian perusahaan akan dihadapkan pada tantangan perilaku, daya beli, selera dan sosial budaya. Pengelolaan perusahaan dituntut untuk selalu tanggap dan jeli dalam melihat situasi lingkungan perusahaan yaitu pasar tempat perusahan melakukan aktivitas pemasaran dan perubahan-perubahan yang terjadi di lingkungan perusahaan.Upaya untuk mencapai tujuan pemasaran produk dengan demikian perusahaan perlu memahami dan mempelajari bagaimana perilaku keputusan pembelian konsumen dalam usaha memenuhi kebutuhan dan keinginan konsumen. Karena bagi konsumen, pasar menyediakan berbagai pilihan, produk serta merek beraneka ragam dan konsumen bebas memilih produk yang akan dibelinya.
    Seiring dengan berkembangnya teknologi, masyarakat Indonesia khususnya yang hidup di wilayah perkotaan mulai mengalami perubahan gaya hidup. Bagi mereka, ponsel tidak hanya digunakan sebagai alat telepon atau sms saja, tetapi mereka juga sudah memperhatikan fitur-fitur lainnya yang mulai terdapat pada semua jenis dan tipe handphone yang beredar di pasaran konsumen secara tepat. Jadi kemampuan perusahaan untuk memposisikan produknya dan memperkenalkan atau memberikan informasi tentang karakteristik atribut produknya dengan baik kepada para konsumen merupakan kunci keberhasilan pemasaran produk atau jasa yang ditawarkan.
    Fenomena keberadaan telepon genggam merupakan tuntutan masyarakat yang cenderung dalam berkomunikasi dengan produk telepon yang berkualitas, bervariasi, penyampaian informasi yang dimiliki produk mudah diterima. Oleh karena itu, Sejak pertama kali BlackBerry diperkenalkan tahun 1997 oleh prusahaan RIM (Research in Motion) Kanada ini, Ponsel cerdas (smartphone) kini banyak di pakai secara luas. Bagi sebagian pemakai BlackBerry merupakan simbol mode (gaya hidup), konsumen menggemari BlackBerry karena kecanggihan fitur layanan yang dimilikinya. Pemakaian BlackBerry sudah tidak mengenal batas usia, pekerjaan, ataupun atribut-atribut status sosial lainnya. Kemampuan operator menyediakan inovasi layanan BlackBerry dengan basis tarif yang kian terjangkau. Atribut produk yang bersifat teknis tercermin pada produk itu atau yang merupakan inti dari produk itu (Core product) antara lain :
    1.Terletak pada koneksi GPRS nya

    2.Kekuatan batterynya lebih tahan lama

    3.Data compression technique di Blackberry yang amat hebat.

    4. Data Loss Prevention (Bila HP.Blackberry didiamkan tanpa battery data terakhir akan tetap tersimpan

    5. Masalah security sehinnga Blackberry aman dari virus

    6. Configuration free (fungsi internet browsing, social network, gprs, mms dan sebagainya langsung tersetting secara otomatis
    7. Memiliki Software
    8. Memiliki komunitas Blackberry Messenger pada setiap pengguna Blackberry
    9. Mempunyai aplikasi auto text back up, berry buzz, blink, OS, PIN, Anti Mosquitto Plus, File Manager Pro, File Scout

    Sedangkan atribut nonteknis dapat ditampilkan dalam beberapa macam bentuk antara lain:
    1. Desain Produk
    2. Bungkus atau kemasan
    3. Merek (Brand) :
    a. Nama merek (brand name)
    b. Trade Mark (merek dagang, simbol merek)

    Pada saat sekarang potensi pemasaran produk Blackberry di Indonesia sangat menjanjikan. Pertama dilihat dari jumlah penduduknya sebanyak 237.556.363 pada tahun 2010 (menurut sensus penduduk Indonesia). Sekitar 10% saja bisa dirangkul menjadi pelanggan setia itu berarti 2.375.563 orang. suatu jumlah yang fantastik dan itu terdata 2 tahun lalu,mungkin pada saat sekarang jumlah konsumen setia Blackberry meningkat seiring dengan makin banyak nya peluncuran produk-produk baru yang di keluarkan RIM. Merebaknya penggunaan layanan BlackBerry tentunya juga tidak terlepas dari berbagai upaya yang dilakukan oleh tiga operator yaitu Indosat, Telkomsel dan XL. Tidak hanya dari sisi fungsionalnya saja, tetapi juga upaya menjadikan penggunaan BlackBerry sebagai bagian dari gaya hidup..
    Selain itu, merek handphone pun sudah menjadi pilihan gaya hidup mereka, merek yang lebih terkenal di kalangan masyarakat Indonesia maka akan lebih diminati daripada merek lainnya yang belum terkenal atau bahkan tidak terkenal sama sekali. Contohnya adalah handphone merek Nokia yang sudah dikenal di pasaran oleh masyarakat Indonesia pada umumnya. Dulu Nokia adalah Brand ternama untuk gadget handphone di Indonesia. Nokia pertama kali diciptakan pertama kali di Finlandia, dan mulai beroperasi pada awal tahun 1980. Sejak berdiri Nokia telah berhasil memimpin di pasaran, dan bisnis Nokia telah berkembang di semua negara untuk memenuhi kebutuhan pelanggan dan perkembangan industri telekomunikasi di negara-negara tersebut termasuk Indonesia. Nokia sejak dahulu telah menjadi penguasa pasar ponsel dunia, akan tetapi makin banyak merek-merek pesaing bermunculan yang siap menggeser pangsa pasar Nokia sebagai market leader sementara. Buktinya, Nokia mencatat hasil kuartalan terburuk dalam satu dekade ini.
    Di tahun 2009, Nokia mengalami penurunan laba operasional sebesar 96%. Kuartal pertama, Nokia menghasilkan laba operasional hanya sebesar 55 juta Euro, sedangkan tahun sebelumnya Nokia berhasil mencetak laba sebesar 1,5 miliar Euro. Penurunan perolehan laba Nokia sangat turun tajam, bila dibandingkan dengan tahun sebelumnya. Press release yang diterbitkan Nokia mengungkapkan bahwa volume penjualan Nokia semakin menurun, dari tahun ke tahun dan beruntut. Pada kuartal ke2 nya Nokia hanya berhasil memperoleh laba bersih 380 juta Euro dari penjualan senilai 13,5 miliar Euro. Hal tersebut juga tampak pada segmen handphone lainnya seperti ponsel pintar alias smartphone yang sedang menjadi tren saat ini.
    Faktor-faktor yang berpotensi mengakibatkan pilihan konsumen adalah faktor konsumen individual, pilihan merek disebabkan oleh kebutuhan konsumen, persepsi dari karakteristik merek dan perilaku alternatif. Pilihan merek yang disebabkan oleh demografi konsumen, gaya hidup, karakteristik personal, dampak lingkungan dan strategi pemasaran juga berdampak pada pengambilan keputusan serta lingkungan pembelian konsumen yang tercermin dari budaya (norma sosial, subkultur suku dan wilayah) Kelompok tatap muka (teman, anggota keluarga dan kelompok referensi).
    Oleh karena itu pemasar perlu memahami bagaimana perilaku konsumen dalam usaha memuaskan kebutuhan dan keinginannya. Perilaku konsumen merupakan suatu proses pengambilan keputusan yang mensyaratkan aktivitas individu untuk mengevaluasi, mencari, menggunakan barang dan jasa sehingga memuaskan kebutuhan. Promosi merupakan cara menjual produk melalui tenaga penjualan yang terampil dalam menyampaikan pesan-pesan. Dimana tujuan utama promosi adalah menginformasikan, mempengaruhi dan membujuk pembeli untuk belanja, serta mengingatkan pelanggan sasaran tentang perusahaan. Informasi pada konsumen berupa informasi pasar mengenai keberadaan suatu produk, cara pemakaian produk, perubahan harga serta membangun citra perusahaan. Pemasar perlu mengembangkan strategi yang membantu pembeli mempelajari atributatribut produk dan tingkat kepentingan relatif mereka, serta yang menarik perhatian pada reputasi merek perusahaan dalam atribut-atribut yang lebih penting. Berdasarkan latar belakang tersebut, penulis mengadakan penelitian “Analisis promosi penjualan dan minat konsumen pada produk Blackberry dan Nokia di Indonesia”

    1.2 Rumusan masalah
    Berdasarkan latar belakang masalah yang telah dikemukakan diatas dapat dirumuskan masalah sebagai berikut:
    1. Apakah atribut dan aplikasi dari Blackberry dapat mempengaruhi peningkatan penjualan dan dapat bersaing dengan perusahaan telepon seluler lain seperti Nokia ?
    2. Apa pengaruh dari promosi terhadap keputusan pembelian telepon seluler ?
    3. Apa saja yang dilakukan dalam meningkatkan minat konsumen terhadap layanan yang dapat di temui pada telpon seluler Blackberry ?
    1.3 Tujuan penelitian
    Sesuai dengan latar belakang dan perumusan masalah yang ditentukan maka tujuan penelitian yang hendak dicapai adalah:
    1. Untuk mengetahui dan menganalisis faktor-faktor yang dipertimbangkan konsumen dalam mengambil keputusan membeli ponsel BlackBerry atau Nokia.
    2. Peneliti diharapkan dapat menganalisa pengaruh promosi terhadap keputusan pembelian ponsel ?
    3. Peneliti diharapkan dapat merumuskan implikasi manajerial dalam meningkatkan minat konsumen melalui layanan yang telah diberikan oleh Blackberry?

    1.4 Manfaat Penelitian
    Adapun manfaat dari penelitian ini adalah sebagai berikut:
    1. Bagi perusahaan dan instansi-instansi yang terkait dengan produk BlackBerry dan Nokia, dapat menjadi pertimbangan perusahaan guna meningkatkan kualitas produk terhadap konsumen dan menjadi penilaian terhadap faktor yang dipertimbangkan konsumen dalam memutuskan membeli Handphone BlackBerry atau Nokia
    2. Bagi peneliti, menerapkan teori-teori yang pernah didapat dan yang dipelajari selama mengikuti perkuliahan yang berhubungan dengan masalah yang telah dikemukakan diatas sehingga dapat diharapkan ilmu tersebut dapat diterapkan dengan baik dan benar.
    3. Bagi Universitas, memberikan informasi sebagai bahan studi lebih lanjut bagi yang ingin mengadakan penelitian yang berkaitan dengan topik yang sama serta memberikan sumbangan bagi karya tulis ilmiah di perpustakaan

    1.5 Tinjauan pustaka
    a.Landasan teori
    1. Pengertian pemasaran
    1.Pengertian Pemasaran
    Sehubungan dengan permasalahan yang terdapat dalam penelitian ini maka diperlukan adanya teori-teori atau konsep-konsep yang memerlukan penjelasan. Dalam benyak perusahaan dewasa ini, pemasaran memegang peranan sebagai suatu faktor penting untuk tetap bertahan menjalankan usaha dan bergelut dalam dunia persaingan. Pemasaran merupakan factor vital sebagai strategi pesrusahaan dalam menjalankan usahanya, yang terutama berhubungan dengan konsumen. Kata pemasaran sendiri berasal dari kata pasar, atau bias juga diartikan dengan mekanisme yang mempertemukan permintaan dan penawaran.
    Menurut Kotler ( 2002 : 9 ) “Pemasaran adalah proses social yang didalamnyaa individu dan kelompok mendapatkan apa yang meraka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produks yang bernilai dengan pihak lain”.
    Menurut Stanton ( 1996 : 6 ) “Pemasaran adalah suatu system keseluruhan dari kegiatan-kegiatan usaha yang ditujukan untuk merencanakan, menentukan harga, mempromosikan, mendistribusikan barang dan jasa yang dapat memuaskan kebutuhan baik kepada pembeli yang ada meupun pembeli potensial”.
    Menurut Lamb, Hair, Me Daniel ( 2001 : 6 ) “Pemasaran adalah suatu proses perencanaan dan menjalankan konsep, harga, promosi, dan sejumlah ide, barang, dan jasa untuk menciptakan pertukaran yang mampu memuaskan tujuan individu dan organisasi”.
    Dari ketiga definisi diatas dapat ditarik kesimpulan bahwa pada dasarnya pemasaran bukan hanya kegiatan menjual barang maupun jasa tetapi juga meliputi kegiatan untuk memenuhi keinginan dan kebutuhan dengan berusaha mempengaruhi konsumen untuk bersedia membeli barang dan jasa perusahaan melalui penciptaan, penawaran, dan pertukaran produk yang bernilai. Hal ini sangat penting bagi manajer pemasaran untuk memahami tingkah laku konsumen tersebut. Sehingga perusahaan dapat mengembangkan, menentukan harga, mempromosikan, dan mendistribusikan produk secara lebih baik. Dengan mempelajari prilaku konsumen, manajer akan mengetahui kesempatan, mengidentifikasi, serta menentukan segmentasi pasar secara tepat dan akurat.
    2. Prilaku konsumen
    Menurut Peter J. Paul dan jerry C. Olson ( 2000 : 6 ) “Prilaku konsumen merupakan interaksi dinamis antara pengaruh dan kondisi prilaku dan kejadian di sekitar lingkungan di mana manusia melakukan aspek pertukaran dalam kehidupan mereka”.
    Menurut ahli ekonomi di Italia, Petro Guido, dalam The No-Need Society masyarakat atau konsumen sebenarnya tidak membutuhkan apa-apa. Justru perusahaan lah yang menciptakan pasar . Dalam hal ini Blackberry menciptakan pasar Smart Phone, bahwan konsumen tidak membutuhkan telepon seluler dengan berbagai atribut canggih sampai barang tersebut beredar maka masyarakat merasa membutuhkan Smart Phone tersebut.
    Dari dua jenis definissi di atas dilihat ada dua hal penting dari prilaku konsumen yaitu proses pengembalian keputusan dan kegiatan fisik yang semuanya ini melibatkan individu dalam menilai, mendapatlkan dan mempergunakan barang-barang dan jasa secara ekonomis. Dengan kata lain prilaku konsumen adalah ilmu yang mempelajari tingkah laku konsumen dalam arti tindakan-tindakan yang dilakukan untuk membeli suatu barang atau jasa tertentu.

    3.Faktor-faktor Yang Mempengaruhi Prilaku Pembelian Konsumen
    Menurut Kotler ( 2002 : 183 ) Faktor-faktor yang mempengaruhi prilaku pembelian konsumen yaitu :
    a.Faktor Kebudayaan
    Kebudayaan mempunyai penaruh paling luas dan mendalam terhadap prilaku konsumen. Terdiri dari budaya, sub budaya, dan kelas social. Budaya yang merupakan karakter paling penting dari suatu social yang membedakannya dari kelompok budaya lain menjadi penentu dan keinginan dan prilaku yang paling mendasar. Masing-masing budaya terdiri dari sub budaya yang memberikan lebih banyak ciri-ciri dan sosialisasi.
    b.Faktor Sosial
    Pada umumnya konsumen sering meminta pendapat dari orang sekitas dan lingkungannya tentang produk apa yang harus dibeli. Karena itulah lingkungan sosial memberikan pengaruh terhadap prilaku konsumen. Faktor Sosial terdiri dari 3 bagian, yaitu : kelompok acuan, keluarga, dan peran
    c.Faktor Pribadi
    Pilihan barang yang dibeli secara otomatis dipengaruhi oleh keadaan ekonomi dan gaya hidup yang bersangkutan. Gaya hidup adalah cara hidup seseorang yang terlihat melalui aktivitas sehari-hari, minat dan pendapat seseorang. Selain itu kepribadian dan konsep diri juga mempengaruhi pilihan produk. Konsep diri adalah bagaimana konsumen mempresepsikan diri mereka sendiri, yang meliputi sikap, persepsi, keyakinan, dan evaluasi diri. Karena sangat berguna dalam menganalisis prilaku sonsumen sehingga banyak perusahaan menggunakan konsep yang berhubungan dengan kepribadian seseorang.

    d.Faktor Psikologis
    Sikap pembelian psikologis dipengaruhi oleh empat facktor psikologis utama, yaitu : motivasi, persepsi, pembelajaran dan kepercayaan. Motivasi merupakan kebutuhan yang mendorong seseorang dalam melakukan sesuatu sesuai dengan tujuan yang ingin dicapai. Melalui motivasi proses pengamatan dan belajar seseorang memperoleh kepercayaan terhadap suatu produk yang secara otomatis mempengaruhi prilaku pembelian konsumen. Para konsumen mengembangkan beberapa kenyakinan mengenai ciri-ciri dari suatu produk dan selanjutnya akan membentuk suatu sikap konsumen terhadap produk tersebut

    BAB II
    METODE PENELITIAN

    A.Lokasi Penelitian
    Penelitian ini mengambil lokasi pada tempat-tempat dimana telpon seluler Blackberry dan Nokia di pasarkan .
    B.Populasi dan Sampel
    1.Populasi Penelitian
    Populasi dalam penlitian ini adalah seluruh mahasiswa fakultas Ekonomi Universitas Jambi yang membeli serta menggunakan telepon seluler merk BlackBerry dan Nokia, dan Narasumber pemasok Blackberry di Jambi.
    2.Sampel Penelitian
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan dan, waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 50 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat.

    C.Jenis dan Sumber Data
    1.Jenis Data
    Jenis data dalam penelitian ini berupa :
    a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, dan skema seperti literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
    b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).
    2.Sumber Data
    Sumber data dalam penelitian ini berupa :
    a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara.
    b.Data Sekunder, yaitu data yang diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.
    D.Teknik Pengumpulan Data
    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah Interview, yaitu suatu metode pengumpulan data dengan cara mengadakan wawancara langsung dengan responden dengan bantuan daftar pertanyaan untuk mengumpulkan data primer.
    Metode penelitian juga menggunakan metode kuantitatif dengan metode komparatif untuk membandingkan aspek-aspek yang terdapat dalam atribut BlackBerry.
    E.Variabel penelitian
    Variabel yang akan digunakan dalam penelitian ini adalah :
    1.VAriabel terikat (Y) : Prilaku konsumen dalam pembelian telepon seluler BlackBerry dan Nokia di Indonesia.
    2.Variabel bebas (X) : Kebutuhan konsumen, keputusan pembelian, atribut atau aplikasi dan promosi.
    Untuk mengetahui hasil tanggapan responden terhadap variabel-veriabel penelitian maka digunakan data interval dengan skala 0-10. Sedangkan untuk mengetahui pengukuran dan interpretasi data, maka data interval dibagi menjadi 5 (lima) skor interval sebagai berikut :
    0 ≤ 2 Skor 1
    2,1 ≤ 4 Skor 2
    4,1 ≤ 6 Skor 3
    6,1 ≤ 8 Skor 4
    8,1 ≤ 10 Skor 5
    F.Definisi Operasional Variabel
    1.Kebutuhan konsumen (X1)
    Melihat tanggapan konsumen mengenai variabel kebutuhan konsumen maka yang lbih menarik perhatian adalah membuat konsumen memerlukan barang tersebut.
    2.Keputusan pembelian (X2)
    Gambaran produk Blackberry dan Nokia yang diinginkan konsumen dalam memberikan kesenangan dan kepuasan. Indikatornya adalah :

    X2.1Jenis Model
    Penilaian konsumen terhadap berbagai tipe pilihan telpon seluler Blackberry atau Nokia yang ditawarkan oleh produsen.
    X2.2Warna
    Penilaian konsumen terhadap ragam pilihan warna yang ada padajenis telpon seluler tersebut.
    X2.3Penampilan Luar (Body)
    Penilaian konsumen terhadap penampilan luar telpon seluler Blackberry dibandingkan dengan produksi pesaingnya seperti Nokia.
    X2.4 Kelebihan yang ditawarkan
    Penilaian konsumen terhadap sejumlah kelebihan yang ditawaarkan pada telpon seluler Blackberry di bandingkan dengan telpon seluler Nokia adalah salah satu faktor penunjang terjadinya keputusan pembelian.
    Keempat indicator di atas diukur berdasarkan tingkat kesenangan dan kepuasan konsumen.

    3.Atribut atau Aplikasi (X3)
    Melihat tanggapan konsumen telepon seluler mengenai Atribut dan Aplikasi yang di tawarkan oleh Blackberry :
    X3.1Kemudahan dalam mengakses dunia maya
    Penilaian konsumen pada saat menggunakan Blackberry saat mengakses di Internet
    X3.2Koneksi GPRS nya mudah
    Penilaian konsumen terhadap menangkap signal saat digunakan untuk bertelekomunikasi
    X3.3 Data compression technique di Blackberry dan data Loss Prevention yang amat hebaat.

    6.Promosi (X4)
    Suatu bentuk komunikasi pemasaran seperti akivitas untuk menyebarkan informasi, mempengaruhi, membujuk konsumennya untuk membeli Blackberry
    X4.1Tanggapan konsumen terhadap iklan Blackberry yang disampaikan oleh pemasar. DApat diukur dri frekuensi, luas jangkauan, serta ukuran.

    DAFTAR PUSTAKA

    Stanton, William J.1996. Prinsip Pemasaran (terjemahan). Edisi 7,jilid 1.Erlangga. Jakarta.
    Lamb,Hair,Mc Daniel.2001. Pemasaran (terjemahan).Edisi Bahasa Indonesia,Jilid Pertama.Salemba empat.Jakarta.
    Kotler, Philip.2002.Manajemen Pemasaran (terjemahan).Edisi Millenium, jilid 1.PT. Prenhallindo. Jakarta.
    Enggel,Blackwell,Miniard.1994. Prilaku Konsumen (terjemahan).Edisi Enam.Jilid Pertama.Binarupa Aksara.Jakarta.
    Fitriadi,Agus.2003. Analisis beberapa factor yang mempengaruhi keputusan dalam pembelian pada UD Microcom di Banjarmasin,Sripksi.Universitas Lambung Mangkurat Banjarmasin.
    Arikunto,Suharsimi.2002. Prosedur Penelitian.Edisi Revisi V.PT.Rineka Cipta.Jakarta.
    http://www.detiknet.com/.Peningkatan konsumen Blackberry di indonesia.
    http://www.detik.com/net.Pemasaran yang dilakukan perusahaan RIM Blackberry dengan peluncuran produk pertama di Indonesia.
    http://www.berryindo.com/. Blackberry dan atribut-atribut penunjang.

    Komentar oleh johannessimatupang | Januari 11, 2012 | Balas

  115. Yudi, Jambi itu mewakili provinsi atau kota. Jadi anda perlu memperjelas lokasi penelitianmu dimana. Perbaikan ditunggu.

    Komentar oleh johannessimatupang | Januari 12, 2012 | Balas

  116. Nama :Muhammad zuhdi azwar
    Nim :C1B008054

    TUGAS JUDUL SKRIPSI

    ANALISIS KEPUASAN PELANGGAN DALAM MELAKUKAN KEPUTUSAN PEMBELIAN MOTOR RODA DUA MERK HONDA PT.SINAR SENTOSA PRIMATAMA JAMBI

    Pak tugas proposal nya sudah saya kirim ke email bapak. TRIMAKASIH

    Komentar oleh M.ZUHDI AZWAR | Januari 12, 2012 | Balas

  117. Nama : Ayu Pratiwi
    Nim : c1b008055
    Tugas proposal Skripsi MEP

    ANALISIS PERILAKU KONSUMEN DALAM MEMUTUSKAN MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD.
    BAB 1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian

    Pada dasarnya produk Mie Instan diketahui adalah salah satu produk makanan cepat saji yang semakin lama semakin banyak digemari oleh masyarakat khalayak luas,karena proses pembuatannya yang mudah membuat masyarakat tidak perlu susah payah membuatnya. Produk ini pun biasa dikonsumsi dengan harga yang relative terjangkau,mudah didapatkan dan sifatnya tahan lama.
    Produk ini pun bisa dibeli dari kalangan bawah sampai menengah atas, dan produk yang dikeluarkan mie instan ini pun tentunya beragam. Dari segi kemasan serta peningkatan kualitasnya pun masih berbeda. Dengan semakin banyaknya merek mie instan yang ada di pasaran berarti memberikan keleluasan bagi konsumen untuk memilih merek yang sesuai dengan keinginannya. Oleh karena itu sangat perlu bagi perusahaan untuk menganalisis perilaku konsumen untuk mengetahui pola pembeliannya. Dengan banyaknya merek mie instan yang ada dipasaran akan mendorong perusahaan bersaing mendapatkan calon konsumen melalui berbagai stategi yang tepat. Misalnya mengubah kemasan yang menarik, aroma, warna, promosi dan harga.
    Minat beli adalah kecenderungan responden untuk bertindak sebelum keputusan benar-benar membeli dilaksanakan. Terdapat perbedaan antara pembelian aktual dan minat pembelian ulang. Bila pembelian aktual adalah pembelian yang benar-benar dilakukan oleh konsumen. Maka minat pembelian ulang adalah niat untuk melakukan pembelian kembali kepada kesempatan mendatang.
    Keinginan untuk membeli merupakan tendensi konsumen untuk membeli suatu produk. Pengukuran keinginan untuk membeli tersebut merupakan suatu hal yang penting dalam pengembangan strategi. Selain itu perlu diperhatikan bahwa keputusan untuk membeli suatu produk dipengaruhi oleh dua hal yaitu sikap dan pendirian orang lain dan faktor situasi yang tidak diantisipasi. Sampai dimana pengaruh orang tersebut terdapat memutuskan minat beli konsumen ditentukan oleh intensitas dari pendirian negatif orang lain terhadap alternatif yang disuka konsumen dan motivasi konsumen untuk menuruti orang lain. Sedangkan pengaruh faktor situasi yang diantisipasi terhadap minat beli konsumen didasarkan pada faktor seperti pendapatan keluarga yang diharapkan, dan melihat produk yang diharapkan. Produsen pun harus lebih jauh lagi dalam mendistribusikan produknya kepasar konsumen berusaha agar produknya dapat diterima dengan sesuai apa yang diinginkan oleh konsumen.
    Tabel 1.1 berikut memperlihatkan berbagai macam variasi, harga dan rasa dari mie instan merek Indofood antara lain :

    Tabel 1.1
    Daftar Harga dan Variasi Mie instan Pada
    Merek Indofood
    No Nama Produk Harga Persatuan Harga Per Dus
    1 Indomie Kuah Kari Rp 1.400 Rp 48.272
    2 Indomie Kuah Ayam Bawang Rp 1.400 Rp.48.272
    3 Indomie Goreng Rp 1.500 Rp 49.500
    Sumber : PT.Indomaret

    Tabel 1.1 diatas menunjukkan adanya perbedaan harga dan variasi dari mie instan pada merek Indofood. Perlu diketahui mie instan yang pangsa pasarnya selama ini dikuasai oleh PT.Indofood, kini pangsa pasarnya semakin kecil dengan masuknya banyak pendatang baru mie instan.
    Oleh karena itu menjadi menarik untuk melakukan penelitian mengenai kebijaksanaan tersebut dan melaporkan hasilnya dalam bentuk skripsi dengan judul “ANALISIS PERILAKU KONSUMEN DALAM MEMUTUSKAN MEMBELI PRODUK MIE INSTAN MEREK INDOFOOD’’.

    1.2 Perumusan Masalah
    “ Bagaimana tingkat kepuasan konsumen dalam memutuskan membeli produk mie instan merek Indofood ’’

    1.3 Tujuan Penelitian dan Manfaat Penelitian

    1.3.1 Tujuan Penelitian
    Penelitian ini bertujuan :
    1. Untuk memperoleh tingkat kepuasan konsumen dalam memutuskan pembelian produk mie instan merek Indofood.
    2. Untuk menganalisis perilaku konsumen dalam memutuskan membeli produk mie instan merek Indofood.

    1.3.2 Manfaat Penelitian
    Manfaat yang diharapkan dari adanya penelitian ini adalah :
    1. Hasil penelitian menjadi bahan penulisan skripsi yang merupakan salah satu syarat memperoleh gelar sarjana ekonomi.
    2. Hasil penelitian ini dapat menjadi masukan bagi PT.Indofood Jambi dimasa yang akan datang dalam usahanya untuk meningkatkan kinerja penjualannya.
    3. Dapat menjadi referensi bagi orang-orang yang berminat terhadap topik ini.

    BAB II

    TINJAUAN PUSTAKA

    2.1 Definisi-definisi
    Untuk memperjelas penulisan ini, maka perlu kiranya dikemukakan berupa pengertian :
    1. Manajemen
    Menurut Terry dan Rue (2001, hal 1) Manajemen adalah suatu proses atau kerangka kerja yang melibatkan bimbingan atau pengarahan suatu kelompok orang-orang ke arah tujuan-tujuan organisasional atau maksud-maksud yang nyata.
    2. Pemasaran
    Menurut Kotler (2002, hal 9) pemasaran adalah suatu proses sosial yang di dalamnya individu atau kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengan menciptakan, menawarkan dan secara bebas mempertukarkan produk yang bernilai dengan pihak lain.

    3. Manajemen Pemasaran
    Menurut Kotler (2002, hal 9) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan pemikiran, penetapan harga, promosi serta penyaluran gagasan, barang dan jasa untuk menciptakan pertukaran yang memenuhi sasaran-sasaran individu dan organisasi.
    4. Produk
    Menurut Angipora (2002, hal 4) Produk adalah sesuatu yang dapat ditawarkan pada suatu pasar untuk mendapatkan perhatian untuk dimiliki, penggunaan ataupun konsumsi yang bisa memuaskan keinginan ataupun kebutuhan.
    5. Promosi
    6. Keputusan Pembeli

    Komentar oleh AYU PRATIWI | Januari 12, 2012 | Balas

  118. Nama : M.Zuhdi Azwar
    Nim : C1B008054
    Tugas Proposal Skripsi MEP

    ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI

    BAB1
    PENDAHULUAN

    1.1 Latar Belakang Penelitian
    Persaingan produk yang semakin ketat yang ditandai dengan munculnya persaingan untuk produk sejenis dengan berbagai kemudahan dan tingkat harga yang relatif lebih rendah, mendorong setiap perusahaan untuk lebih meningkatkan image terhadap produk yang ditawarkannya. Karena persaingan yang ada akan membuat konsumen semakin banyak pilihan dengan berbagai merek dalam melaksanakan keputusan pembelian dengan harga yang bervariasi di pasaran yang tersebar di berbagai daerah. Dalam kondisi yang demikian, perusahaan tidak dapat hanya memusatkan perhatiannya pada produk yang ditawarkan tetapi juga membuat strategi yang tepat agar produk yang dihasilkan dapat menarik perhatian konsumen dari berbagai macam produk yang ditawarkan oleh pesaing lainnya.
    Banyaknya jenis kendaraan bermotor roda dua yang ditawarkan pada saat ini dengan berbagai keunggulan yang ada merupakan suatu keuntungan bagi konsumen. Konsumen dapat memilih sesuai dengan kriteria yang diinginkannya. Criteria ini menjadi pendorong utama mereka dalam kepuasan pembelian kendaraan bermotor roda dua. Beberapa jenis kendaraan roda dua dengan berbagai spesifikasi menawarkan kemudahaan dan keunggulan, mulai dari pembelian hingga perawatan. Masing-masing agen dan dealer berlomba merebut pasar yang ada.
    Untuk lebih jelasnya penjualan kendaraan bermotor roda dua merek Honda di Kota Jambi dapat dilihat pada tabel berikut ini :

    Tabel 1.1 Total Penjualan Kendaraan Bermotor Roda Dua Merek Honda di Kota Jambi Tahun
    2001-2005
    Tahun Total penjualan Honda (Unit) Pangsa Pasar
    2001 23.657 18.668 78,91
    2002 24.324 19.325 79,44
    2003 28.030 20.731 73,96
    2004 30.246 21.009 69,46
    2005 35.650 24.938 69,95
    Rata-rata 74,34
    Sumber : PD. Sinar Sentosa

    Tabel 1.1 di atas menunjukkan bahwa selama tahun 2001-2005 pangsa pasar kendaraan bermotor roda dua merek Honda di Kota Jambi rata-rata sebesar 74,34 persen. Hal ini menunjukkan bahwa kendaraan bermotor roda dua merek Honda menguasai sebagian besar penjualan kendaraan bermotor roda dua di Kota Jambi. Namun demikian, menilik perkembangan data pangsa pasar di atas terlihat terjadinya penurunannya penjualan pada tahun 2003 yakni sebesar 73,96 persen, dan terus mengalami penurunannya di bawah 70 persen pada tahun 2004 dan 2005. Hal ini sebagai cerminan semakin ketatnya persaingan dalam merebut pangsa pasar kendaraan bermotor, khusunya di Kota Jambi.
    Pada dasarnya tujuan suatu bisnis adalah untuk menciptakan pelanggan yang merasa puas. Terciptanya kepuasan akan memberikan dampak diantaranya hubungan yang baik antara perusahaan dan dan konsumen, memberikan dasar yang baik bagi pembelian ulang dan loyalitas pelanggan dan membentuk suatu rekomendasi dari mulut ke mulut yang menguntungkan perusahaan.
    Berdasarkan uraian di atas, terlihat bahwa kepuasan konsumen dalam pembelian produk motor merek Honda mempengaruhi perilaku untuk mengkonsumsinya. Oleh karena itu peneliti tertarik untuk mengetahui gambaran kepuasan konsumen dalam melakukan pembelian motor merek Honda secara lebih lanjut dalam bentuk skripsi dengan judul :
    “ANALISIS KEPUASAN PELANGGAN TERHADAP PEMBELIAN PRODUK MOTOR HONDA PADA PD.SINAR SENTOSA JAMBI’’.

    1.2 Perumusan Masalah
    Kendaraan bermotor merk Honda selama periode 2001-2005 menguasai pangsa pasar kendaraan bermotor roda dua lebih dari 74,34 persen.keberhasilan ini tidakterlepas dari kepuasan konsumen dalam memperoleh pelayanan kepuasan konsumen. Namun demin demikian dengan penurunan penguasaan pangsa pasar selama dua tahun terakhir dibawah 70% mengidikasikan semakin ketatnya persaingan penjualan kendaraan bermotor roda dua merk Honda.
    Dariuraian diatas maka masalah yang akan diteliti adalah sebagaiberikut:
    “ Bagaimana tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi?’’

    1.3 Tujuan Penelitian dan Manfaat Penulisan
    1.3.1 Tujuan Penelitian
    adapun tujuan penelitian ini adalah :
    1. Untuk mengukur tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.
    2. Untuk menganalisis tingkat kepuasan pelanggan terhadap pembelian produk motor roda dua merek Honda pada PD.Sinar Sentosa Jambi.

    1.3.2 Manfaat Penelitian
    Adapun manfaat penelitian ini adalah :
    1. Secara akdemis hasil penelitian ini diharapkan menjadi salah satu referensi bagi penelitian-penelitian selanjutnya untuk menguji topic yang sama dengan penelitian ini.
    2. Secara praktis hasil penelitian ini diharapkan menjadi sumbangan pemikiran bagi agen tunggal pemegang merek, khususnya Honda dalam memperluas pasar.

    BAB II
    TINJAUAN PUSTAKA
    2.1 Definisi-Definisi
    Menurut William.J. Stanton (1997, hal 7) Pemasaran adalah suatu system total dari kegiatan bisnis yang direncanakan untuk menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan baik kepada konsumen saat ini maupun konsumen potensial.
    Menurut P. Kothler (1994, hal 4) Manajemen Pemasaran adalah proses perencanaan dan pelaksanaan konsep, penetapan harga, promosi dan distribusi barang dan jasa untuk menghasilkan pertukaran yang memenuhi sasaran perorangan dan organisasi.

    Komentar oleh M.ZUHDI AZWAR | Januari 12, 2012 | Balas

  119. Nama :Donni Saragih
    Nim :EC1B010020

    EKSTENSI SORE

    Judul proposal MEP: Upaya Meningkatkan Mutu Dan Kualitas Pelayanan Pada PT.BANK MANDIRI Tbk Cabang Jambi

    Donni, judulmu mirip ke Judul Buku. Ganti, sehingga dari judul kelihatan ada sesuatu yg harus diteltiti.
    Dooni, kalau judul salah bukan berarti topiknya tidak potensil. Silahkan cari judul sesuai dg topik. Misalnya topik tentaang KUR, Usaha Mikro dll. Saya mendorong mahasiswa meneliti berkaitan dg tugas dan pekerjaannnya.

    Komentar oleh DONNI SARAGIH | Januari 14, 2012 | Balas

  120. Nama : Donni Saragih
    Nim : EC1B010020

    Ekstensi Sore

    Judul Proposal MEP

    _ Upaya meningkatkan mutu dan kualitas pelayanan pada PT.BANK MANDIRI.Tbk cabang jambi

    Komentar oleh Donni Saragih | Januari 15, 2012 | Balas

  121. Malam pak Jo
    maaf pak saya terlambat mengirim perbaikan judul proposal tentatif saya
    komen ya pak

    Nama : Nasrudin
    Nim : C1B008104
    MGT G’08

    Tugas judul proposal MEP
    “Analisis Tingkat Produksi Pabrik Kelapa Sawit Terhadap Volume Penjualan CPO Kelapa Sawit di PTP. Nusantara IV Bunut Inti Sungai Bahar”

    Judulmu ini terlalu ribet, belum menunjukkan fokus yg mau diteliti. Cepat diperbaiki, minggu depa kita sudah harus memeriksa proposal tentatif.

    Komentar oleh Nasrudin | Januari 15, 2012 | Balas

    • malam pak jo
      maaf pak bagaimana dengan judul yang saya ajukan kemarin
      terimakasih ya pak

      Komentar oleh nasrudin | Januari 16, 2012 | Balas

  122. malem pak jo,,maaf saya telat untuk menganti judul skripsi,,karna judul pertama memang ribet,,jadi saya tukar..

    Nama : Lidya anastasia
    Nim : ERC1B009020
    Kelas : ektensi siang
    Tugas Skripsi MEP

    Judul : ANALISIS KEPUASAN KONSUMEN TERHADAP PELAYANAN PURNA JUAL PADA PT. SUTAN KASIM CABANG JAMBI

    mohon dikomentari pak..terimakasih

    Lidya judul ini ok, silahkan dilanjuti dg proposal tentatif.

    Komentar oleh LIDYA ANASTASIA | Januari 16, 2012 | Balas

    • Terimakasih pak

      Komentar oleh Lidya anastasia | Januari 17, 2012 | Balas

  123. jika pak jo setuju dengan judul skripsi yang saya ganti,
    Saya akan melnjutkan nya pak…
    Trimakasih..

    Komentar oleh Lidya anastasia | Januari 16, 2012 | Balas

  124. maaf pak jo ini judul skripsi saya yang baru mohon di komentari

    nama : MARHAMAH
    nim: ERC1B009061
    kelas : sore

    “ANALISIS STRATEGI PEMASARAN UNTUK MENINGKATKAN PENJUALAN KENDARAAN MOBIL PADA CV MEGA GEMILANG MOTOR”

    Strategi pemasaran topiknya luas, persempit saja ehingga dapat diteliti lebih mudah dan mendalam.

    Komentar oleh MARHAMAH | Januari 17, 2012 | Balas

  125. ANALISIS PREFERENSI PELANGGAN KOPI
    DI KEDAI KOPI JAMBI

    BAB I

    1.1 Latar belakang

    Kedai kopi adalah salah satu coffe shop yang cukup ternama di jambi. Kedai kopi merupakan salah satu franchise dari kedai kopi jogja. Dari tahun 2008 -2010 permintaan konsumen terus meningkat, peningkatan ini di duga terjadi antara lain karena daya tarik efisiensi biaya dan sering nya menyelenggarakan event. Seiring berjalan nya waktu, di tahun 2011 penurunan tingkat suku bunga cukup meningkat, Hal ini terjadi karena persaingan yang cukup ketat. Untuk memperkuat dan meningkatkan penjualan di kedai kopi jambi, maka perlu di bangun strategi pemasaran yang logis. Kendala yang di hadapi adalah belum teridentifikasinya konsumen kopi ini secara jelas. Alasan melatar belakangi individu dalam memilih suatu produk, penting di ketahui agar pihak produsen dapat merumuskan strategi yang tepat dalam menjangkau dan mendekatkan produk kepada konsumen.

    1.2 Rumusan masalah

    Tahap awal yang penting di lakukan dalam memahami konsumen adalah melakukan kajian tentang preferensi konsumen berkaitan dgn sikap dan pilihan dalam menilai produk di kedai kopi jambi. Identifikasi yang di lakukan berkaitan juga dengan perilaku konsumen produk ini.

    1.3 Tujuan penelitian

    Berdasarkan permasalahan yang akan di kaji, maka secara spesifik tujuan penelitian ini adalah : 1. Mengetahui karakteristik dan perilaku konsumen di kedai kopi jambi.
    2. Identifikasi kebutuhan (Needs), keinginan (wants), preferensi pelanggan kopi di kedai kopi jambi
    3. Merumuskan rekomendasi guna perancangan strategi pemasaran produk.
    1.4 Manfaat penelitian

    Manfaat penelitian ini di harapkan dapat memberikan gambaran dan pemahaman bagi pihak produsen di kedai kopi jambi.

    Ivan, judulmu masih multitafsir, antara preferensi, needs, keinginan. Mana yg akan dijadikan fokus. Selanjutnya, belum ditunjukkan siapa populasi dan pengambilan sampel seperti apa. Perbaiki poin ini, tambahkan juga referensimu belum ada.

    Komentar oleh johannessimatupang | Januari 17, 2012 | Balas

  126. Selamat malam pak jo salam sejahtera selalu
    Maaf pak jo ini judul skripsi saya yg baru mohon di komentari karna judul yang lama disuruh perbaiki

    “ANALISIS PENGARUH SALURAN DISTRIBUSI TERHADAP PENJUALAN KERUPUK TEMPE TAKIARI KOTA JAMBI”

    Proposalmu ditunggu.

    Komentar oleh Marhamah | Januari 17, 2012 | Balas

    • baik pak trima kasih :)

      Komentar oleh MARHAMAH | Januari 18, 2012 | Balas

  127. BAB I
    PENDAHULUAN

    1.1 Latar Belakang Masalah
    Globalisasi disegala bidang sudah terjadi dan berpengaruh secara langsung terhadap kondisi Indonesia yang meliputi bidang politik, ekonomi, pendidikan, teknologi dan bahkan bidang sosial budaya. Dari berbagai bidang Indonesia banyak tertinggal dengan negara-negara di kawasan Asia Tenggara sendiri. Dalam hal ini kemajuan suatu negara diikuti oleh pemasaran produk dan jasa pada perekonomian nasional. Semakin maju suatu negara, maka kesejahteraan masyarakatnya semakin meningkat.
    Dalam menghadapi era globalisasi, bangsa indonesia siap bersaing dan berbenah diri, guna untuk mengejar ketertinggalan dari negara lain. Sejalan dengan kemajuan dan perkembangan industri ditentukan dengan sumber daya manusia yang handal dan terampil untuk menghadapi pesatnya persaingan industri. Dalam hal ini pemerintah membuat kebijakan yang berdampak positif terhadap industri menengah, agar nantinya bisa terbuka peluang pasar sehingga industri–industri yang ada di indonesia terus berkembang dan mampu berdaya saing.
    Perusahaan yang bergerak di bidang industri masa kini harus memikirkan kembali misi bisnis dan strategi pemasaran mereka secara keritis, hal ini perlu karena banyaknya perusahaan yang bersaing secara tidak sehat, seharusnya mereka bersaing dengan ketentuan etika bisnis dan undang-undang yang berlaku. Kebijaksanaan pemasaran yang terkelola dengan baik akan meningkatkan kesetiaan pelanggan dan penjualan berhasil ditingkatkan. Salah satunya dengan meningkatkan produk yang inovatif dan ditambah dengan dukungan iklan-iklan, baik itu media cetak maupun elektronik .
    Usaha kecil dan menengah merupakan sektor yang sangat menunjang dan sering dijadikan sebagai indikator keberhasilan pembangunan suatu daerah. Usaha kecil dan menengah adalah sektor yang menguasai hajat hidup orang banyak, baik itu usaha yang kecil maupun usaha kecil yang telah berkembang menjadi sebuah usaha yang besar. Karena setiap keberhasilan serta perkembangannya dapat menentukan taraf hidup masyarakat. Salah satu UKM (Usaha Kecil dan Menengah) yang sedang berkembang saat di Propinsi Jambi , tepatnya di Kota Jambi yaitu usaha yang menjual pakaian (Distro) berupa bermacam jenis pakaian yang biasanya dibutuhkan oleh masyarakat sebagai kebutuhan sandang, karena pakaian adalah kebutuhan pokok yang harus dipenuhi setalah kebutuhan pangan.
    Dari awal mulanya produk yang dijual adalah dalam jumlah merek yang relatif kecil, Kemudian terus berkembang menjual produk berbagai jenis merek yang ada dari berbagai industri pakaian. Adapun usaha kecil menengah dalam penelitian pada tugas akhir ini adalah Distro The Zombie. Dalam usaha kecil dan menengah kita mengenal ada beberapa kegiatan salah satunya pada strategi pemasaran. Strategi pemasaran merupakan salah satu faktor penting yaitu sebagai kegiatan peningkatan efesiensi penjualan sehingga semakin banyak pesanan dari konsumen yang akhir penjualan bisa meningkat, sehingga usaha akan terus berkembang.
    Berdasarkan uraian diatas maka judul tugas akhir ini adalah “ANALISIS PERSONAL SELLING PAKAIAN MEREK STARCROSS DISTRO THE ZOMBIE JAMBI”.

    1.2 Batasan Masalah
    Mengingat luasnya cakupan masalah yang ada pada usaha distro The Zombie, untuk itulah adanya batasan masalah agar nantinya lebih terarah dalam penulisan tugas akhir ini, adupun batasan masalahnya yaitu mengenai strategi pemasaran pakaian merek starcross yang telah diterapkan oleh distro The Zombie Jambi.

    1.3 Rumusan Masalah
    Berdasarkan latar belakang dan batasan masalah yang dikemukakan diatas adapun rumusan masalahnya adalah:
    a. Strategi pemasaran apa saja yang telah diterapkan distro The Zombie dalam memasarkan produk pakaian merek starcross ?
    b. Seberapa besar market share produk pakaian merek starcross pada distro The Zombie untuk wilayah Kota Jambi ?

    1.4 Tujuan Penelitian
    Adapun yang menjadi tujuan penelitian dari penyusunan tugas akhir ini adalah:
    a. Untuk mengetahui strategi pemasaran apa saja yang telah diterapkan pada distro The Zombie dalam memasarkan produk pakaian merek starcross.
    b. Untuk mengetahui besarnya market share produk pakaian merek starcross untuk wilayah Kota Jambi yang telah dicapai oleh distro The Zombie bila dibandingkan dengan distro lain yang sejenis.

    1.5 Manfaat Penelitian
    Manfaat yang dapat diperoleh dari penelitian ini adalah:
    a. Untuk menambah pengetahuan dan wawasan terutama yang berkaitan dengan strategi pemasaran.
    b. Dengan adanya penelitian ini dapat mengetahui bagaimana cara penjualan produk pakaian merek starcross.
    c. Sebagai bahan informasi kepada distro The Zombie dan bagi para pembaca mengenai strategi pemasaran.
    d.

    Kalau judulnya berkaitan dg personal selling, maka tujuan penelitian jangan lagi pakai Strategi PEmasaran, ini kurang sinkron.

    Komentar oleh johannessimatupang | Januari 18, 2012 | Balas

  128. NAMA : FERRY ANGRIAWAN
    NIM : ERC1B009032
    PROPOSAL TENTATIF

    BAB I

    I.I. Latar Belakang
    Sebagai salah satu Negara beriklim tropis, yang memiliki dua iklim setiap tahunnya. Indonesia mengalami musim kemarau dan musim hujan,tetapi pada saat sekarang ini akibat dari pemanasan global mengakibatkan terkadan iklim di Indonesia tidak menentu,kapan terjadinya musim hujan dan musim kemarau.
    Karena akibat tidak menentunya iklim di Indonesia saat ini menimbulkan beberapa faktor yang terjadi pada sebagian masyarakat di Indonesia, contohnya terjadi pada kesehatan kulit. Mulai dari kulit yang kering,mengelupas,dan sebagainya.
    Untuk mengatasi masalah – masalah kulit yang terjadi akibat dari perubahan iklim yang tidak menentu dari pemanasan global. Masyarakat Indonesia membutuhkan sabun mandi ayang mampu melindungi dari factor situasi itu dalam beraktivitas sehari – hari,terutama bagi para pria yang sebagian besar aktivitas kesehariannya dilakukan di luar ruangan dan berada pada keadaan cuaca yang extreme.
    Sebab itu sekarang ini banyak sekali terdapat produk sabun mandi berbagai macam merek,yang ditawarkan perusahaan kepada konsumen. Produk itu seperti, lifeboys, biore shower mens,nivea for mens,dan GATSBY SHOWER GEL. Dimana masing – masing merek tersebut saling berusaha untuk membuat produk mereka lebih unggul dari merek lain. Seperti produk dari PT.mandom.tbk, Yang memproduksi GATSBY shower gel yang memiliki cirri khusus yang dapat menarik minat dan mempengaruhi konsumen dalam mengambil keutusan pembelian.karena Menurut Kotler ( 2002 : 9 ) “Pemasaran adalah proses social yang didalamnyaa individu dan kelompok mendapatkan apa yang meraka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produks yang bernilai dengan pihak lain”.

    GATSBY shower gel menjadi pilihan konsumen pria dikota jambi, dan khususnya para fotogarafer di grup pasukan jepret jambi, karena aktivitas fotografer banyak dilakukan di udara panas dan kadng secara ektrem menjadi hujan. Karena GATSBY memiliki kandungan khusus untuk pria yaitu terdapat DOUBLE DEO Protectioan yang mampumembunuh bakteri penyebab bau badan dan MENTHOL menjaga dan menyegarkan kulit dalam kondisi cuaca yang ektrem.
    Itulah hal yang duharapkan mampu menarik perhatian konsumen dan memahami prilaku konsumen dalam pengambilan keputusan ,untuk mencoba memenuhi kebutuhan, karena Dalam memahami prilaku konsumen tentu tidak mudah karena konsumen mempunyai sifat yang berbeda-beda sebagaimana dari kebutuhan manusia yang tidak terbatas disamping dipengaruhi oleh kondisi eksternal dan internal lainnya yang berakibat langsung terhadap prilaku konsumen. Faktor eksternal yang dimaksud meliputi kebudayaan, sub budaya,kelas social,kelompok social, kelompok referensi, dan keluarga. Sedangkan factor internal adalah factor yang ada pada diri konsumen itu sendiri (psikologis) yang meliputi: belajar, kepribadian, dan konsep diri,serta sikap (Stanton,1996:155).

    Karena itulah Gatsby shower gel telah menjadi tuntutan Para pria , khususnya para fotografer dikota jambi, melihat keadaan inilah penulis sangat tertarik untuk melakukan penelitian dengan judul “ ANALISIS FAKTOR SITUASIONAL TERHADAP PEMBELIAN GATSBY SHOWER GEL DIKOTA JAMBI “.

    1.2. Rumusan Masalah
    Beradasarkan latar belakang masalah yang telah dikemukakan , maka dapat di indentifikasi beberapa hal sebagai berikut :
    Tidak menentunya cuaca di Indonesia ,karena disebabkan factor situasional dari dampak pemanasan global. Pemanasan global banyak menimbulkan efek negatif , bagi perubahan iklim yang tidak menentu di Indonesia. Salah satunya pada dunia kesehatan,yaitu kesehatan kulit, Oleh karena itu sabun mandi merupakan pelindung kesehatan dari cuaca extreme. Dan Gatsby shower gel merupakan salah satu pilihan dari berbagai merek produk lain bagi para fotografer dikota jambi.
    Sehingga berdasarkan uraian diatas maka permasalahan dapat dikemukakan sebagai berikut :
    Apakah factor situasional seperti cuaca mempengaruhi prilaku konsumen dan memutuskan membeli produk ?
    Apakah faktor situasional menjadi suatu factor yang dominan dalam pengambilan keputusan ?

    1.3. Tujuan penelitian
    Berdasarkan rumusan masalah masalah diatas , Tujuan penelitianyang hendak dicapai adalah :
    Untuk mengetahi apakah factor situasional dapat mempengaruhi konsumen dalam mengembil keputusan pembelian Gatsby shower gel.
    Untuk mengetahui apakah factor situasional cuaca mempunyai pengaruh dominan dalam konsumen memgambil keputusan pembelian Gatsby shower gel.

    1.4. Manfaat penelitian
    Bagi Perusahaan
    Penelitia ini diharapkan jadi pertimbangan dan masukan bagi perusahaan dalam menetapkan kebijakan strategi dapat dipertimbangankan dari factor situasional unuk mengembangkan usaha mereka,sesuai dengana apa yang dibutuhkan konsumen.
    Bagi pihak lain
    Penelitian ini dapat menjadi pengetahuan tentang factor situasi dalam pemasaran dan meningkatkan pengetahuan informasi ,masyarakat tentang produk Gatsby shower gel . Dan daoat sebagai acuan bagi penulis lain untuk penelitian selanjutnya.
    Bagi penulis
    Dengan adanya penelitian ini, penulis dapat menerapkan teori – teori yang telah di berikan selama perkuliahan,dapat pula mengetahui hasil penelitian dan ilmu dari penelitian tersebut. Dan dapat diterapkan secara baik dan benar.

    BAB II
    METODE PENELITIAN

    2.1. Lokasi penelitian

    Penelitian ini mengambil lokasi pada basecamp grup fotogrefer pasukan jepret jambi (PJJ) . Alamat villa kenali permai blok i 1 no 11. Mayang mangurai simpang 3 sipin, JAMBI 36126.

    2.2. Sampel penelitian
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan dan, waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 50 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat.

    2.3. Jenis pengumpulan data
    1.Jenis Data
    Jenis data dalam penelitian ini berupa :
    a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, skema, dan gambar, sepertu literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
    b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).
    2.Sumber Data
    Sumber data dalam penelitian ini berupa :
    a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.
    b.Data Sekunder, yaitu data yng diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari situasi-situasi internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.
    2.4 Teknik Pengumpulan Data

    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    a.Interview, yaitu suatu metode pengumpulan data dengan cara mengadakan wawancara langsung dengan responden dengan bantuan daftar pertanyaan untuk mengumpulkan data primer.
    b.Kuesioner, yaitu suatu teknik pengumpulan data yang dilakukan dengan cara memberikan seperangkat pertanyaan atau pertanyaan tertulis pada responden untuk menjawab.

    2.5 Variabel penelitian

    Variabel yang akan digunakan dalam penelitian ini adalah :
    1.VAriabel terikat (Y): Faktor situasional keadaan cuaca yang mempengaruhi dalam pembelian GATSBY shower gel
    2.Variabel bebas (X) : kebutuhan konsumen, keputusan pembelian,factor dominan pembelian.
    Untuk mengetahui hasil tanggapan responden terhadap variabel-veriabel penelitian maka digunakan data interval dengan skala 0-10. Sedangkan untuk mengetahui pengukuran dan interpretasi data, maka data interval dibagi menjadi 5 (lima) skor interval sebagai berikut :
    0 ≤ 2 Skor 1
    2,1 ≤ 4 Skor 2
    4,1 ≤ 6 Skor 3
    6,1 ≤ 8 Skor 4
    8,1 ≤ 10 Skor 5

    2.6 Definisi Operasional Variabel
    1.Kebutuhan konsumen (X1)
    Melihat tanggapan konsumen mengenai variable kebutuhan maka lebih menarik perhatian adalah bagaimana cara agar konsumen dapat memerlukan barang tersebut,karena faktor situasional.
    2. Keputusan pembelian.
    Gambaran produk GATSBY shower gel yang diinginkan konsumen,dalam memberikan kepuasan. Indikatornya adalah

    X1. Kandungan yang ditawarkan pada produk GATSBY
    Penilaian konsumen untuk melihat kandungan yang terdapat pada produk yang mampu untuk menjaga kulit dari cuaca extreme.
    X2. Penampilan kemasan
    Penilaian konsumen terhadap penilaian kemasan yang unik dan mudah disimpan dibandingkan produk lain.
    X3. Kelebihan yang ditawarkan
    Penilaian konsumen dalam kelebihan yang ditawarkna produk dilihat dari manfaat kandunngan double deo untuk melindungi kulit.

    DAFTAR PUSTAKA

    Stanton, William J.1996. Prinsip Pemasaran (terjemahan). Edisi 7,jilid 1.Erlangga. Jakarta.
    Arikunto,Suharsimi.2002. Prosedur Penelitian.Edisi Revisi V.PT.Rineka Cipta.Jakarta.
    Kotler, Philip.2002.Manajemen Pemasaran (terjemahan).Edisi Millenium, jilid 1.PT. Prenhallindo. Jakarta.
    mandom.co.id/product.php?lang=&topcat=1000071&subTopID=1000080&parentcat=1000086
    Majour.maranatha.edu/index.php/jurnal-manajemen/article/view/168pdf
    Syadiashare.com/iklim-di-indonesia-html

    Komentar oleh ferry angriawan | Januari 18, 2012 | Balas

  129. Maaf pak, saya lupa mencantumkan judul nya
    ” ANALISIS PENGARUH FAKTOR SITUASIONAL TERHADAP PEMBELIAN GATSBY SHOWER GEL DIKOTA JAMBI “

    Komentar oleh ferry angriawan | Januari 18, 2012 | Balas

  130. NAMA : FERRY ANGRIAWAN
    NIM : ERC1B009032
    PROPOSAL TENTATIF
    Judul : ” ANALISIS PENGARUH FAKTOR SITUASIONAL TERHADAP PEMBELIAN PRODUK GATSBY SHOWER GEL DIKOTA JAMBI ”

    BAB I

    I.I. Latar Belakang
    Sebagai salah satu Negara beriklim tropis, yang memiliki dua iklim setiap tahunnya. Indonesia mengalami musim kemarau dan musim hujan,tetapi pada saat sekarang ini akibat dari pemanasan global mengakibatkan terkadan iklim di Indonesia tidak menentu,kapan terjadinya musim hujan dan musim kemarau.
    Karena akibat tidak menentunya iklim di Indonesia saat ini menimbulkan beberapa faktor yang terjadi pada sebagian masyarakat di Indonesia, contohnya terjadi pada kesehatan kulit. Mulai dari kulit yang kering,mengelupas,dan sebagainya.
    Untuk mengatasi masalah – masalah kulit yang terjadi akibat dari perubahan iklim yang tidak menentu dari pemanasan global. Masyarakat Indonesia membutuhkan sabun mandi ayang mampu melindungi dari factor situasi itu dalam beraktivitas sehari – hari,terutama bagi para pria yang sebagian besar aktivitas kesehariannya dilakukan di luar ruangan dan berada pada keadaan cuaca yang extreme.
    Sebab itu sekarang ini banyak sekali terdapat produk sabun mandi berbagai macam merek,yang ditawarkan perusahaan kepada konsumen. Produk itu seperti, lifeboys, biore shower mens,nivea for mens,dan GATSBY SHOWER GEL. Dimana masing – masing merek tersebut saling berusaha untuk membuat produk mereka lebih unggul dari merek lain. Seperti produk dari PT.mandom.tbk, Yang memproduksi GATSBY shower gel yang memiliki cirri khusus yang dapat menarik minat dan mempengaruhi konsumen dalam mengambil keutusan pembelian.karena Menurut Kotler ( 2002 : 9 ) “Pemasaran adalah proses social yang didalamnyaa individu dan kelompok mendapatkan apa yang meraka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produks yang bernilai dengan pihak lain”.

    GATSBY shower gel menjadi pilihan konsumen pria dikota jambi, dan khususnya para fotogarafer di grup pasukan jepret jambi, karena aktivitas fotografer banyak dilakukan di udara panas dan kadng secara ektrem menjadi hujan. Karena GATSBY memiliki kandungan khusus untuk pria yaitu terdapat DOUBLE DEO Protectioan yang mampumembunuh bakteri penyebab bau badan dan MENTHOL menjaga dan menyegarkan kulit dalam kondisi cuaca yang ektrem.
    Itulah hal yang duharapkan mampu menarik perhatian konsumen dan memahami prilaku konsumen dalam pengambilan keputusan ,untuk mencoba memenuhi kebutuhan, karena Dalam memahami prilaku konsumen tentu tidak mudah karena konsumen mempunyai sifat yang berbeda-beda sebagaimana dari kebutuhan manusia yang tidak terbatas disamping dipengaruhi oleh kondisi eksternal dan internal lainnya yang berakibat langsung terhadap prilaku konsumen. Faktor eksternal yang dimaksud meliputi kebudayaan, sub budaya,kelas social,kelompok social, kelompok referensi, dan keluarga. Sedangkan factor internal adalah factor yang ada pada diri konsumen itu sendiri (psikologis) yang meliputi: belajar, kepribadian, dan konsep diri,serta sikap (Stanton,1996:155).

    Karena itulah Gatsby shower gel telah menjadi tuntutan Para pria , khususnya para fotografer dikota jambi, melihat keadaan inilah penulis sangat tertarik untuk melakukan penelitian dengan judul “ ANALISIS FAKTOR SITUASIONAL TERHADAP PEMBELIAN GATSBY SHOWER GEL DIKOTA JAMBI “.

    1.2. Rumusan Masalah
    Beradasarkan latar belakang masalah yang telah dikemukakan , maka dapat di indentifikasi beberapa hal sebagai berikut :
    Tidak menentunya cuaca di Indonesia ,karena disebabkan factor situasional dari dampak pemanasan global. Pemanasan global banyak menimbulkan efek negatif , bagi perubahan iklim yang tidak menentu di Indonesia. Salah satunya pada dunia kesehatan,yaitu kesehatan kulit, Oleh karena itu sabun mandi merupakan pelindung kesehatan dari cuaca extreme. Dan Gatsby shower gel merupakan salah satu pilihan dari berbagai merek produk lain bagi para fotografer dikota jambi.
    Sehingga berdasarkan uraian diatas maka permasalahan dapat dikemukakan sebagai berikut :
    Apakah factor situasional seperti cuaca mempengaruhi prilaku konsumen dan memutuskan membeli produk ?
    Apakah faktor situasional menjadi suatu factor yang dominan dalam pengambilan keputusan ?

    1.3. Tujuan penelitian
    Berdasarkan rumusan masalah masalah diatas , Tujuan penelitianyang hendak dicapai adalah :
    Untuk mengetahi apakah factor situasional dapat mempengaruhi konsumen dalam mengembil keputusan pembelian Gatsby shower gel.
    Untuk mengetahui apakah factor situasional cuaca mempunyai pengaruh dominan dalam konsumen memgambil keputusan pembelian Gatsby shower gel.

    1.4. Manfaat penelitian
    Bagi Perusahaan
    Penelitia ini diharapkan jadi pertimbangan dan masukan bagi perusahaan dalam menetapkan kebijakan strategi dapat dipertimbangankan dari factor situasional unuk mengembangkan usaha mereka,sesuai dengana apa yang dibutuhkan konsumen.
    Bagi pihak lain
    Penelitian ini dapat menjadi pengetahuan tentang factor situasi dalam pemasaran dan meningkatkan pengetahuan informasi ,masyarakat tentang produk Gatsby shower gel . Dan daoat sebagai acuan bagi penulis lain untuk penelitian selanjutnya.
    Bagi penulis
    Dengan adanya penelitian ini, penulis dapat menerapkan teori – teori yang telah di berikan selama perkuliahan,dapat pula mengetahui hasil penelitian dan ilmu dari penelitian tersebut. Dan dapat diterapkan secara baik dan benar.

    BAB II
    METODE PENELITIAN

    Lokasi penelitian

    Penelitian ini mengambil lokasi pada basecamp grup fotogrefer pasukan jepret jambi (PJJ) . Alamat villa kenali permai blok i 1 no 11. Mayang mangurai simpang 3 sipin, JAMBI 36126.

    Sampel penelitian
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan dan, waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 50 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat.

    2.3. Jenis pengumpulan data
    1.Jenis Data
    Jenis data dalam penelitian ini berupa :
    a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, skema, dan gambar, sepertu literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
    b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).
    2.Sumber Data
    Sumber data dalam penelitian ini berupa :
    a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.
    b.Data Sekunder, yaitu data yng diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari situasi-situasi internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.
    2.4 Teknik Pengumpulan Data

    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    a.Interview, yaitu suatu metode pengumpulan data dengan cara mengadakan wawancara langsung dengan responden dengan bantuan daftar pertanyaan untuk mengumpulkan data primer.
    b.Kuesioner, yaitu suatu teknik pengumpulan data yang dilakukan dengan cara memberikan seperangkat pertanyaan atau pertanyaan tertulis pada responden untuk menjawab.

    2.5 Variabel penelitian

    Variabel yang akan digunakan dalam penelitian ini adalah :
    1.VAriabel terikat (Y): Faktor situasional keadaan cuaca yang mempengaruhi dalam pembelian GATSBY shower gel
    2.Variabel bebas (X) : kebutuhan konsumen, keputusan pembelian,factor dominan pembelian.
    Untuk mengetahui hasil tanggapan responden terhadap variabel-veriabel penelitian maka digunakan data interval dengan skala 0-10. Sedangkan untuk mengetahui pengukuran dan interpretasi data, maka data interval dibagi menjadi 5 (lima) skor interval sebagai berikut :
    0 ≤ 2 Skor 1
    2,1 ≤ 4 Skor 2
    4,1 ≤ 6 Skor 3
    6,1 ≤ 8 Skor 4
    8,1 ≤ 10 Skor 5

    2.6 Definisi Operasional Variabel
    1.Kebutuhan konsumen (X1)
    Melihat tanggapan konsumen mengenai variable kebutuhan maka lebih menarik perhatian adalah bagaimana cara agar konsumen dapat memerlukan barang tersebut,karena faktor situasional.
    2. Keputusan pembelian.
    Gambaran produk GATSBY shower gel yang diinginkan konsumen,dalam memberikan kepuasan. Indikatornya adalah

    X1. Kandungan yang ditawarkan pada produk GATSBY
    Penilaian konsumen untuk melihat kandungan yang terdapat pada produk yang mampu untuk menjaga kulit dari cuaca extreme.
    X2. Penampilan kemasan
    Penilaian konsumen terhadap penilaian kemasan yang unik dan mudah disimpan dibandingkan produk lain.
    X3. Kelebihan yang ditawarkan
    Penilaian konsumen dalam kelebihan yang ditawarkna produk dilihat dari manfaat kandunngan double deo untuk melindungi kulit.

    DAFTAR PUSTAKA

    Stanton, William J.1996. Prinsip Pemasaran (terjemahan). Edisi 7,jilid 1.Erlangga. Jakarta.
    Arikunto,Suharsimi.2002. Prosedur Penelitian.Edisi Revisi V.PT.Rineka Cipta.Jakarta.
    Kotler, Philip.2002.Manajemen Pemasaran (terjemahan).Edisi Millenium, jilid 1.PT. Prenhallindo. Jakarta.
    mandom.co.id/product.php?lang=&topcat=1000071&subTopID=1000080&parentcat=1000086
    Majour.maranatha.edu/index.php/jurnal-manajemen/article/view/168pdf
    Syadiashare.com/iklim-di-indonesia-html

    Faktor Situasional belum dijelaskan, jelaskan apa yg anda maksud gd faktor situasional. Daftar pustakamu ok.

    Komentar oleh ferry angriawan | Januari 18, 2012 | Balas

  131. pak jo saya mau perbaiki judul saya sesuai dengan saran bapak pada perkuliahan tertanggal 11 januari 2012
    Nama : Wahyu Afero
    Nim : ERC1B009013
    Kelas : ektensi siang

    Judul : “PENGARUH CITRA TOKO TERHADAP MINAT BELI KONSUMEN PADA MINI MARKET TRI D MART”
    terimakasih pak jo

    Ok, proposal tentatifmu ditunggu.

    Komentar oleh wahyu afero | Januari 18, 2012 | Balas

  132. NAMA: Akbar Maulana
    NIM: C1B008126

    “ANALISIS KUALITAS PELAYANAN JASA PADA PT.POS INDONESIA (persero) CABANG TALANG BANJAR JAMBI”

    BAB 1
    PENDAHULUAN
    1.1 Latar belakang masalah
    Persaingan bisnis di bidang jasa pelayanan pengiriman semakin ketat.Persaingan ketat antar jasa pengiriman baik perusahaan pemerintah maupun swasta menyebabkan masing masing perusahaan jasa berusaha memberikan pelayanan dan fasilitas semaksimal mungkin. Untuk dapat bertahan dalam persaingan tersebut, pelaku perusahaan pun dituntut untuk lebih meningkatkankualitas pelayanan yang diberikan.Perusahaan yang telah memahami konsep kualitas dengan benar harusmenyadari tentang pentingnya usaha yang terus menerus kearah penyempurnaankualitas dari produk atau jasa yang dihasilkannya. Penyempurnaan yang berkesinambungan penting artinya dalam mempertahankan daya saing perusahaantersebut, hal ini mengingat bahwa kebutuhan konsumen bersifat dinamis dan berubah – ubah menurut perkembangan zaman. Agar dapat bertahan pada masayang akan datang, maka perusahaan harus terus berusaha meningkatkan kualitassesuai dengan apa yang dibutuhkan oleh konsumen.
    PT. POS INDONESIA (PERSERO)
    sebagai perusahaan pemerintah bergerak dibidang jasa pengiriman yang menyediakan jasa pengiriman seperti:surat, barang, uang serta pelayanan – pelayanan jasa lainnya seperti: pembayaranrumah, pembayaran listrik, tabunag dan lain – lain harus selalu memperhatikantentang kualitas terutama kualitas dalam hal pelayanannya. Hal ini dilakukan agar para konsumen mendapat kepuasan terhadap kulitas pelayanan yang dilakukanoleh
    PT. POS INDONESIA (PERSERO) dan dengan kepuasan ini diharapkan kesetiaan atau loyalitas konsumen.

    1.2 Perumusan Masalah

    Adapun perumusan masalah yang ditemukan dalam penelitian ini adalahsebagai berikut:
    1. Bagaimana cara mendapatkan informasi mengenai kebutuhan dan harapan(ekspektasi dan persepsi) pelanggan atas pelayanan yang diberikan.
    2. .Bagaimana kualitas jasa yang dilakukan PT.POS Indonesia untuk memenuhi kebuthuhan dan permintaan konsumen.
    3. Bagaimana memperkirakan perbaikan – perbaikan yang harus dilakukanoleh PT. POS INDONESIA (PERSERO) Cabang talang banjar jambi untuk meningkatkan kualitan pelayanan dengan memperhatikan keinginan pelanggan.

    1.3 Tujuan Penelitian

    Tujuan penulis mengadakan penelitian ini adalah:
    1. Mendapatkan informasi mengenai kebutuhan dan harapan(ekspektasi dan persepsi) pelanggan atas pelayanan yang diberikan.
    2. Mengetahui seberapa besar GAP ekspektasi dengan persepsi pelanggan atas pelayanan yang telah diberikan di PT. POS INDONESIA(PERSERO) Cabang talang banjar Jambi.
    3. Memperkirakan perbaikan – perbaikan yang harus dilakukan oleh PT. POS INDONESIA (PERSERO) Cabang talang banjar Jambi, untuk meningkatkan kualitas pelayanan dengan memperhatikan keinginan pelanggan.

    1.4 Pembatasan Masalah

    Pembatasan masalah dilakukan agar pembahasan tidak melebar ke persoalan – persoalan lainnya. Dalam penulisan ini analisa yang dilakukan berdasarkan batasan – batasan berikut ini:
    1. Lima dimensi Servqual dijadikan sebagai acuan pengukuran objek yangditeliti.
    2. Responden yang diteliti adalah pelanggan PT. POS INDONESIA(PERSERO) cabang Talang banjar jambi.
    3. Perusahaan yang diteliti adalah perusahaan jasa dengan jasa pelayanan pengiriman.

    BAB II
    TINJAUAN PUSTAKA

    2.1 pengertian jasa
    Jasa merupakan suatu hasil yang diciptakan melalui aktifitas dalamketerkaitan diantara pemasok dan pelanggan dan melalui aktifitas internal pemasok, untuk memenuhi kebutuhan pelanggan.
    Jasa sebagai setiap tindakan atau perbuatan yang dapat ditawarkanoleh suatu pihak kepada pihak lain yang pada dasarnya bersifat
    Intangible (tidak berwujud fisik) dan tidak menghasilkan kepemilikan sesuatu. Produksi jasa bisa berhubungan dengan produk fisik maupun tidak. (Tjiptono,1997:134).
    Yang dimaksud dengan jasa adalah kegiatan, manfaat atau kepuasanyang dapat ditawarkan untuk dijual. Perbedaan secara tegas antara barang dan jasa seringkali sukar dilakukan. Ini disebabkan pembelian suatu barang seringkali disertai dengan jasa-jasa tertentu dan sebaliknya pembelian suatu jasasering jika melibatkan barang-barang yang melengkapinya.
    Adapun sifat-sifatdari jasa, yaitu jasa lebih bersifat abstrak dari pada fisik, jasa bersifatsementara daripada permanent, dan lebih bersifat subyektif dari padaobyektif.Pandangan tentang jasa yaitu lebih menekankan pada kata pelanggan, pelayanan, kua litas dan level atau tingkat. Pelayanan terbaik pada pelanggandan tingkat kualitas dapat dicapai secara konsisten dengan memperbaik.
    pelayanan dan memberikan perhatian khusus pada standar kinerja pelayanan baik standar pelayanan internal maupun standar pelayanan eksternal ( Yamit,2001:22 ).Dari definisi diatas dapat dikatakan bahwa jasa atau pelayanan adalah ketrampilan atau bantuan kepada pihak lain untuk menghasilkan sesuatu yangtak berwujud ( intangible), namun dapat dinikmati. Klasifikasi Jasa
    Sejauh ini banyak pakar yang mengemukakan skema klasifikasi jasa,dimana masing-masing ahli menggunakan dasar perbedaan disesuaikandengan sudut pandangnya sendiri-sendiri.

    2.2 Karakteristik Jasa

    Jasa-jasa umumnya diproduksi secara khusus dan dikonsumsi pada waktu yang bersamaan. Jika jasa diberikan oleh seseorang, maka orang itu merupakan bagian dari jasa tersebut. Karena client juga hadir saat jasa diberikan, maka interaksi penyedia client merupakan ciri khusus dari pemasaran jasa. Baik penyediamaupun client akan mempengaruhi hasil jasa. Variability“Because they depend on who provides them and when and where they are provided, service are highly variable.”
    Jasa itu sangat bervariasi, karena tergantung kepada yang menyediakan dan kapanserta dimana disediakan. Seringkali pembeli jasa menyadari akan keanekaragamanini dan membicarakannya dengan yang lain sebelum memilih seorang penyedia jasa.
    Perishability“Service cannot be stored. The perishability of services is not a problem whendemand is steady. When demand fluctuates, service firms have problems.”
    Jasa tidak dapat disimpan. Keadaan tidak tahan lama dari jasa-jasa bukanlahmasalah jika permintaannya stabil, karena mudah untuk melakukan persiapan pelayanan sebelumnya. Jika permintaan terhadapnya berfluktuasi maka perusahaan jasa menghadapi masalah yang rumit.Berdasarkan definisi-definisi di atas, maka dapat ditarik kesimpulan bahwa padadasarnya jasa memiliki unsur-unsur penting sebagai berikut:

    1. Tidak berwujud.
    2. Tidak memberikan sifat kepemilikan.
    3. Terjadi interaksi antara penyedia jasa dengan konsumen
    4. Dalam proses produksinya bisa berkaitan dengan produk fisik maupuntidak .
    5. Memberikan kepuasan dan memenuhi kebutuhan konsumen.

    jasa yang menekankan pada service delivery system yaitu bagaimanasuatu perusahaan menyampaikan jasa kepada konsumen. Ketepatan strategi pemasaran jasa dari suatu perusahaan ditentukan oleh kualitas jasa yangditawarkan ( perceived service quality) dan diukur oleh jasa yang dirasakankonsumen (service performance/perceived service) serta jasa yang diharapkankonsumen (consumer expectation ). Kualitas jasa keseluruhan merupakan totalitasdari setiap unsur bauran jasa.Terdapat tiga hal yang dapat mempengaruhi seseorang dalam mengkonsumsi jasaantara lain informasi langsung yang diperoleh dari orang lain ( word of mouth ),kebutuhan perorangan yang diperlukan, serta pengalaman dalam pemakaian jasa.

    2.3 Definisi kualitas jasa

    Kualitas jasa sebagai ukuran seberapa bagus tingkat layanan yangdiberikan mampu sesuai dengan ekspektasi pelanggan. Berdasarkan definisiini, kualitas jasa dapat diwujudkan melalui pemenuhan kebutuhan dankeinginan pelanggan serta ketepatan penyampaiannya untuk mengimbangiharapan pelanggan (Tjiptono, 2005:121).Ada dua faktor utama yang mempengaruhi kualitas jasa, yakni: Jasayang diharapkan ( expected service ) dan jasa yang dirasakan ataudipersepsikan perceived service) (Tjiptono, 2005;121).Apabila perceive service sesuai dengan expected service
    , makakualitas jasa tersebut akan dipersepsikan baik atau positif, jika perceive service lebih baik dibandingkan expecte service, maka kualitas jasa tersebutakan dipersepsikan ideal. Sebaliknya jika perceive
    lebih jelek dibandingka expecte service , maka kualitas jasa tersebut akan dipersepsikan buruk ataunegative. Oleh sebab itu baik buruknya kualitas jasa tergantung padakemampuan penyedia jasa dalam memenuhi harapan pelanggannya secara konsisten.

    Dimensi kualitas Jasa

    Beberapa pakar pemasaran seperti Pasuraman, Zeithalm dan Berrymelakukan penelitian khusus terhadap beberapa jenis jasa danmengidentifikasi 10 faktor yang mempengaruhi kualitas jasa yang biasadisebut sebagai dimensi kualitas, yaitu : (Tjiptono, 2005:132)
    1. Reliability, mencakup dua hal pokok, yaitu konsistensi kerja( performance) dan kemampuan untuk dipercaya (dependability)
    2. Responsiveness, yaitu kemauan para karyawan untuk memberikan jasayang dibutuhkan pelanggan.
    3. Tangible, yaitu bukti fisik dari jasa, bisa berupa fasilitas fisik, peralatan yang dipergunakan, representasi fisik dari jasa.
    4. Security, yaitu aman dari bahaya, resiko atau keragu-raguan. Aspek inimeliputi keamanan secara fisik, finansial dan kerahasiaan.
    5. Credibility, yaitu sifat jujur dan dapat dipercaya. Kredibilitas mencakupnama perusahaan, reputasi perusahaan, karakteristik pribadi, contact personel dan interaksi dengan pelanggan.
    6. Communication, artinya memberikan informasi kepada pelanggandalam bahasa yang dapat mereka pahamiserta selalu mendengar keluhandan saran pelanggan.
    7. Understanding Knowing The Costumer , yaitu usaha untuk memahamikebutuhan pelanggan.
    8. Competence , yaitu setiap orang dalam perusahaan memilikiketrampilan dan pengetahuan yang dibutuhkan agar dapat memberikan jasa tertentu.
    9. Acces, meliputi kemudahan untuk dihubungi atau ditemui.
    10. Courtesy , meliputi sikap sopan santun, respek, perhatian dankeramahan yang dimiliki para contact person.

    2.4 Sistematika Penulisan
    Untuk mendapat penulisan yang terarah dan terperinci, maka penulisanlaporan kerja praktek ini disajikan dengan sistematika sebagai berikut:
    BAB I PENDAHULUAN
    Bab ini menguraikan gambaran umum serta penjelasan singkat mengenai permasalahan yang dibahas, meliputi latar belakang masalah, perumusan masalah,tujuan pemecahan masalah, pembatasan masalah, dan membuat sitematika penulisan laporan.
    BAB II TINJAUAN PUSTAKA
    Dalam bab ini diuraikan mengenai teori – teori yang berhubungan denganmetode – metode yang berhubungan dengan pemecahan masalah yang akandibahas.
    BAB III METODE PENELITIAN
    Dalam bab ini berisikan struktur atau flow chart tentang susunan laporanini dan penjelasan fungsi masing – masing.
    BAB IV PENGUMPULAN DAN PENGOLAHAN DATA
    Dalam bab ini memuat data yang diperlukan dan berkaitan dengan penelitian, cara pengolahan data serta analisis dari penelitian yang sudahdilakukan sesuai dengan teori – teori dan metode – metode yang telah dijelaskansehingga menjadi suatu informasi dalam mengambil keputusan.
    BAB V ANALISA
    Dalam bab ini membahas mengenai nalisa – analisa terhadap data yangdiperoleh berdasarkan hasil pengumpulan dan pengolahan data, proses yangdilakukan dan hasil yang diperoleh dari penelitian dan memberikan pandanganmengenai topic yang dibahas.
    BAB VI KESIMPULAN DAN SARAN
    Dalam bab ini berisi kesimpulan yang diperoleh berdasarkan analisisterhadap data yang diperoleh dan saran – saran sehubungan dengan hasil yangdiperoleh.

    DAFTAR PUSTAKA

    Arikunto, Suharsimi. 1998.Prosedur Penelitian. Yogyakarta. Rineka Cipta.
    Ariani,Wahyu.1997.ManajemenKualitas.UniversitasAtmajaya,yogyakarta.
    Supranto,J.1997.Pengukuran Tingkat Kepuasan Pelanggan Untuk Menaikan Pangsa Pasar.Rineka Cipta, Jakarta.
    Supranto, J. 1997.Metode Riset, Aplikasinya dalam pemasaran.Rineka Cipta.Tjiptono. Fandy. 2005.Pemasaran Jasa. Andi. Yogyakarta.
    Umar, Husein. 2000.Riset Pemasaran dan perilaku konsumen. PT.GramediaPustaka Utama, Jakarta.
    Yamit, Z. 2002.Manajemen Kualitas Produk Dan Jasa. Ekonosia, Yogyakarta.

    Komentar oleh Akbar Maulana | Januari 18, 2012 | Balas

  133. Akbar Maulana

    BAB 1
    PENDAHULUAN
    1.1 Latar belakang masalah
    Persaingan bisnis di bidang jasa pelayanan pengiriman semakin ketat.Persaingan ketat antar jasa pengiriman baik perusahaan pemerintah maupun swasta menyebabkan masing masing perusahaan jasa berusaha memberikan pelayanan dan fasilitas semaksimal mungkin. Untuk dapat bertahan dalam persaingan tersebut, pelaku perusahaan pun dituntut untuk lebih meningkatkankualitas pelayanan yang diberikan.Perusahaan yang telah memahami konsep kualitas dengan benar harusmenyadari tentang pentingnya usaha yang terus menerus kearah penyempurnaankualitas dari produk atau jasa yang dihasilkannya. Penyempurnaan yang berkesinambungan penting artinya dalam mempertahankan daya saing perusahaantersebut, hal ini mengingat bahwa kebutuhan konsumen bersifat dinamis dan berubah – ubah menurut perkembangan zaman. Agar dapat bertahan pada masayang akan datang, maka perusahaan harus terus berusaha meningkatkan kualitassesuai dengan apa yang dibutuhkan oleh konsumen.
    PT. POS INDONESIA (PERSERO)
    sebagai perusahaan pemerintah bergerak dibidang jasa pengiriman yang menyediakan jasa pengiriman seperti:surat, barang, uang serta pelayanan – pelayanan jasa lainnya seperti: pembayaranrumah, pembayaran listrik, tabunag dan lain – lain harus selalu memperhatikantentang kualitas terutama kualitas dalam hal pelayanannya. Hal ini dilakukan agar para konsumen mendapat kepuasan terhadap kulitas pelayanan yang dilakukanoleh
    PT. POS INDONESIA (PERSERO) dan dengan kepuasan ini diharapkan kesetiaan atau loyalitas konsumen.

    1.2 Perumusan Masalah

    Adapun perumusan masalah yang ditemukan dalam penelitian ini adalahsebagai berikut:
    1. Bagaimana cara mendapatkan informasi mengenai kebutuhan dan harapan(ekspektasi dan persepsi) pelanggan atas pelayanan yang diberikan.
    2. .Bagaimana kualitas jasa yang dilakukan PT.POS Indonesia untuk memenuhi kebuthuhan dan permintaan konsumen.
    3. Bagaimana memperkirakan perbaikan – perbaikan yang harus dilakukanoleh PT. POS INDONESIA (PERSERO) Cabang talang banjar jambi untuk meningkatkan kualitan pelayanan dengan memperhatikan keinginan pelanggan.

    1.3 Tujuan Penelitian

    Tujuan penulis mengadakan penelitian ini adalah:
    1. Mendapatkan informasi mengenai kebutuhan dan harapan(ekspektasi dan persepsi) pelanggan atas pelayanan yang diberikan.
    2. Mengetahui seberapa besar GAP ekspektasi dengan persepsi pelanggan atas pelayanan yang telah diberikan di PT. POS INDONESIA(PERSERO) Cabang talang banjar Jambi.
    3. Memperkirakan perbaikan – perbaikan yang harus dilakukan oleh PT. POS INDONESIA (PERSERO) Cabang talang banjar Jambi, untuk meningkatkan kualitas pelayanan dengan memperhatikan keinginan pelanggan.

    1.4 Pembatasan Masalah

    Pembatasan masalah dilakukan agar pembahasan tidak melebar ke persoalan – persoalan lainnya. Dalam penulisan ini analisa yang dilakukan berdasarkan batasan – batasan berikut ini:
    1. Lima dimensi Servqual dijadikan sebagai acuan pengukuran objek yangditeliti.
    2. Responden yang diteliti adalah pelanggan PT. POS INDONESIA(PERSERO) cabang Talang banjar jambi.
    3. Perusahaan yang diteliti adalah perusahaan jasa dengan jasa pelayanan pengiriman.

    BAB II
    TINJAUAN PUSTAKA

    2.1 pengertian jasa
    Jasa merupakan suatu hasil yang diciptakan melalui aktifitas dalamketerkaitan diantara pemasok dan pelanggan dan melalui aktifitas internal pemasok, untuk memenuhi kebutuhan pelanggan.
    Jasa sebagai setiap tindakan atau perbuatan yang dapat ditawarkanoleh suatu pihak kepada pihak lain yang pada dasarnya bersifat
    Intangible (tidak berwujud fisik) dan tidak menghasilkan kepemilikan sesuatu. Produksi jasa bisa berhubungan dengan produk fisik maupun tidak. (Tjiptono,1997:134).
    Yang dimaksud dengan jasa adalah kegiatan, manfaat atau kepuasanyang dapat ditawarkan untuk dijual. Perbedaan secara tegas antara barang dan jasa seringkali sukar dilakukan. Ini disebabkan pembelian suatu barang seringkali disertai dengan jasa-jasa tertentu dan sebaliknya pembelian suatu jasasering jika melibatkan barang-barang yang melengkapinya.
    Adapun sifat-sifatdari jasa, yaitu jasa lebih bersifat abstrak dari pada fisik, jasa bersifatsementara daripada permanent, dan lebih bersifat subyektif dari padaobyektif.Pandangan tentang jasa yaitu lebih menekankan pada kata pelanggan, pelayanan, kua litas dan level atau tingkat. Pelayanan terbaik pada pelanggandan tingkat kualitas dapat dicapai secara konsisten dengan memperbaik.
    pelayanan dan memberikan perhatian khusus pada standar kinerja pelayanan baik standar pelayanan internal maupun standar pelayanan eksternal ( Yamit,2001:22 ).Dari definisi diatas dapat dikatakan bahwa jasa atau pelayanan adalah ketrampilan atau bantuan kepada pihak lain untuk menghasilkan sesuatu yangtak berwujud ( intangible), namun dapat dinikmati. Klasifikasi Jasa
    Sejauh ini banyak pakar yang mengemukakan skema klasifikasi jasa,dimana masing-masing ahli menggunakan dasar perbedaan disesuaikandengan sudut pandangnya sendiri-sendiri.

    2.2 Karakteristik Jasa

    Jasa-jasa umumnya diproduksi secara khusus dan dikonsumsi pada waktu yang bersamaan. Jika jasa diberikan oleh seseorang, maka orang itu merupakan bagian dari jasa tersebut. Karena client juga hadir saat jasa diberikan, maka interaksi penyedia client merupakan ciri khusus dari pemasaran jasa. Baik penyediamaupun client akan mempengaruhi hasil jasa. Variability“Because they depend on who provides them and when and where they are provided, service are highly variable.”
    Jasa itu sangat bervariasi, karena tergantung kepada yang menyediakan dan kapanserta dimana disediakan. Seringkali pembeli jasa menyadari akan keanekaragamanini dan membicarakannya dengan yang lain sebelum memilih seorang penyedia jasa.
    Perishability“Service cannot be stored. The perishability of services is not a problem whendemand is steady. When demand fluctuates, service firms have problems.”
    Jasa tidak dapat disimpan. Keadaan tidak tahan lama dari jasa-jasa bukanlahmasalah jika permintaannya stabil, karena mudah untuk melakukan persiapan pelayanan sebelumnya. Jika permintaan terhadapnya berfluktuasi maka perusahaan jasa menghadapi masalah yang rumit.Berdasarkan definisi-definisi di atas, maka dapat ditarik kesimpulan bahwa padadasarnya jasa memiliki unsur-unsur penting sebagai berikut:

    1. Tidak berwujud.
    2. Tidak memberikan sifat kepemilikan.
    3. Terjadi interaksi antara penyedia jasa dengan konsumen
    4. Dalam proses produksinya bisa berkaitan dengan produk fisik maupuntidak .
    5. Memberikan kepuasan dan memenuhi kebutuhan konsumen.

    jasa yang menekankan pada service delivery system yaitu bagaimanasuatu perusahaan menyampaikan jasa kepada konsumen. Ketepatan strategi pemasaran jasa dari suatu perusahaan ditentukan oleh kualitas jasa yangditawarkan ( perceived service quality) dan diukur oleh jasa yang dirasakankonsumen (service performance/perceived service) serta jasa yang diharapkankonsumen (consumer expectation ). Kualitas jasa keseluruhan merupakan totalitasdari setiap unsur bauran jasa.Terdapat tiga hal yang dapat mempengaruhi seseorang dalam mengkonsumsi jasaantara lain informasi langsung yang diperoleh dari orang lain ( word of mouth ),kebutuhan perorangan yang diperlukan, serta pengalaman dalam pemakaian jasa.

    2.3 Definisi kualitas jasa

    Kualitas jasa sebagai ukuran seberapa bagus tingkat layanan yangdiberikan mampu sesuai dengan ekspektasi pelanggan. Berdasarkan definisiini, kualitas jasa dapat diwujudkan melalui pemenuhan kebutuhan dankeinginan pelanggan serta ketepatan penyampaiannya untuk mengimbangiharapan pelanggan (Tjiptono, 2005:121).Ada dua faktor utama yang mempengaruhi kualitas jasa, yakni: Jasayang diharapkan ( expected service ) dan jasa yang dirasakan ataudipersepsikan perceived service) (Tjiptono, 2005;121).Apabila perceive service sesuai dengan expected service
    , makakualitas jasa tersebut akan dipersepsikan baik atau positif, jika perceive service lebih baik dibandingkan expecte service, maka kualitas jasa tersebutakan dipersepsikan ideal. Sebaliknya jika perceive
    lebih jelek dibandingka expecte service , maka kualitas jasa tersebut akan dipersepsikan buruk ataunegative. Oleh sebab itu baik buruknya kualitas jasa tergantung padakemampuan penyedia jasa dalam memenuhi harapan pelanggannya secara konsisten.

    Dimensi kualitas Jasa

    Beberapa pakar pemasaran seperti Pasuraman, Zeithalm dan Berrymelakukan penelitian khusus terhadap beberapa jenis jasa danmengidentifikasi 10 faktor yang mempengaruhi kualitas jasa yang biasadisebut sebagai dimensi kualitas, yaitu : (Tjiptono, 2005:132)
    1. Reliability, mencakup dua hal pokok, yaitu konsistensi kerja( performance) dan kemampuan untuk dipercaya (dependability)
    2. Responsiveness, yaitu kemauan para karyawan untuk memberikan jasayang dibutuhkan pelanggan.
    3. Tangible, yaitu bukti fisik dari jasa, bisa berupa fasilitas fisik, peralatan yang dipergunakan, representasi fisik dari jasa.
    4. Security, yaitu aman dari bahaya, resiko atau keragu-raguan. Aspek inimeliputi keamanan secara fisik, finansial dan kerahasiaan.
    5. Credibility, yaitu sifat jujur dan dapat dipercaya. Kredibilitas mencakupnama perusahaan, reputasi perusahaan, karakteristik pribadi, contact personel dan interaksi dengan pelanggan.
    6. Communication, artinya memberikan informasi kepada pelanggandalam bahasa yang dapat mereka pahamiserta selalu mendengar keluhandan saran pelanggan.
    7. Understanding Knowing The Costumer , yaitu usaha untuk memahamikebutuhan pelanggan.
    8. Competence , yaitu setiap orang dalam perusahaan memilikiketrampilan dan pengetahuan yang dibutuhkan agar dapat memberikan jasa tertentu.
    9. Acces, meliputi kemudahan untuk dihubungi atau ditemui.
    10. Courtesy , meliputi sikap sopan santun, respek, perhatian dankeramahan yang dimiliki para contact person.

    Akbar, sebaiknya mengirimkan tugas sesuai dg yg diminta. Ini sudah dijelaskan waktu kuliah. Selanjutnya produk pos itu harus dibatasi, surat barang aatau jelaskan apa yg hendak diteliti. Judul dan penjelasan di atas belum menunjukkan adanya topik yg baik untuk diteliti.

    Komentar oleh johannessimatupang | Januari 18, 2012 | Balas

  134. NAMA: DALLES MARTENSA
    NIM: C1B008124

    BAB I
    PENDAHULUAN

    A.Latar Belakang
    Pada tahun 2003 dimulainya operasi pemusnahan helm yang bukan standar oleh jajaran kepolisian, ada beberapa warga Jambi yang mengeluh/segan dengan penggunaan helm standar. Berbagai alasan mulai dari kepala terasa berat,tidak nyaman,tidak mendengar kalo ada yang memanggil, dan sebagainya.

    Helm yang baik adalah helm yang aman dan nyaman. Biasanya helm semacam ini lulus persyaratan DOT (Departement of Transportation) atau standar transportasi Amerika Serikat. Ada juga standar-standar lain seperti untuk Eropa, Jepang, bahkan Indonesia sendiri. Apapun itu, helm yang aman adalah helm yang terbuat dari lapisan cangkang luar yang membungkus seluruh kepala dan menyisakan cukup ruang untuk melihat kedepan.Orang-orang sering menyebutnya helm full face. Juga cangkangnya harus lumanyan tebal dan anti benturan.

    Helm yang aman mestinya berbanding lurus dengan tingkat kenyamanan meskipun hampir-hampir tidak ada helm yang benar-benar nyaman. Helm haruslah cukup ringan dan memungkinkan anda melihat dengan jelas, baik kala siang dan malam ataupun teruk hujan. Hindari penggunaan jenis kaca mika yang kurang bening yang mengurangi jarak pandang,terutama saat malam. Kaca yang sudah penuh dengan goresan, sebaiknya diganti. Pilihlah yng berkualitas oleh kebeningan dan tidak berefek cembung atau cekung.

    Sekarang ini banyak sekali terdapat merk-merk helm yang ditawarkan kepada konsumen seperti Arai, Shoe, Nolan, dan merk helm KYT. Dimana masing-masing merk helm tersebut berusaha untuk membuat produknya lebih unggul dibandingkan dengan merk lain. Maka kegiatan pemasaran yang baik dan tepatlah yang memegang peranan yang penting dalam menunjang kelangsungan usaha dan perkembangan suatu perusahaan. Dengan kata lain, pihak produsen harus mampu merebut hati konsumen akan hasil produksi yang dijual dan berupaya untuk memuaskan kebutuhan konsumennya.

    Dalam memahami prilaku konsumen tentu tidak mudah karena konsumen mempunyai sifat yang berbeda-beda sebagaimana dari kebutuhan manusia yang tidak terbatas disamping dipengaruhi oleh kondisi eksternal dan internal lainnya yang berakibat langsung terhadap prilaku konsumen. Faktor eksternal yang dimaksud meliputi kebudayaan, sub budaya,kelas social,kelompok social, kelompok referensi, dan keluarga. Sedangkan factor internal adalah factor yang ada pada diri konsumen itu sendiri (psikologis) yang meliputi: belajar, kepribadian, dan konsep diri,serta sikap (Stanton,1996:155).

    Oleh sebab itu konsumen harus dapat mengendalikan perubahan perilaku tersebut dengan berusaha mengimbanginya, yakni dengan mempengaruhi konsumen dalam membeli produk yang ditawarkan dan melalui evaluasi berkala demi kelangsungan hidup produsen itu sendiri. Tidak semua merk helm yang mampu diminati oleh sebagian besar konsumen yang ada, tetapi hanya beberapa saja.Salah satunya adalah merk KYTyang menjadi pilihan konsumen khususnya mahasisiwa fakultas ekonomi UNJA Universitas Jambi.

    Helm merk KYT ini memiliki kualitas yang berstandar internasional yang menggunakan teknologi dari Italia. Berat helm half face idealnya 1 sampai 1,3 kg, sedangkan untuk helm full face bobotnya berkisar 1,3-1,7 kg.

    Helm KYT nampaknya sudah menjadi tuntutan para pengendara sepeda motor, khususnya mahasiswa. Sering dikatakan oleh para mahasiswa “Kalau naik motor helmnya harus KYT kalo tidak mau di cap tidak gaul”. Melihat keadaan inilah penulis tertarik untuk melakukan penelitian mengenai perilaku konsumen yang merupakan salah satu dasar dalam menerapkan strategi pemasaran untuk mencapai tujuan, yaitu memberikan kepuasan kepada konsumen, sehinggan diharapkan dapat membawa kepada peningkatan penjualan yang berakibat lengsung pada peningkatan pasar.

    B.Rumusan Masalah
    Berdasarkan latar belakang masalah yang telah dikemukakan, maka dapat diidentifikasi beberapa hal sebagai berikut :
    Banyaknya merk-merk helm sepada motor yang ditawarkan oleh produsen kepada konsumen.
    Helm merupakan salah satu penunjang keselamatan berkendaraan yang sangat penting.
    Pentingnya memahami prilaku konsumen untuk meningkatkan penjualan.
    Helm KYT diminati oleh para mahasiswa Fakultas Ekonomi UNJA.

    Sehingga berdasarkan uraian di atas, maka permasalahannya dapat dirumuskan sebagai berikut :
    1.Apakah faktor-faktor seperti harga, selera, kualitas, harga jual kembali, prestise dan promosi secara simultan mempengaruhi prilaku konsumen dalam membeli helm merk KYT?
    2.Dari faktor-faktor tersebut, faktor manakah yang paling dominan memberikan pengaruh terhadap prilaku konsumen terhadap pembelian helm merk KYT?

    C.Tujuan Penelitian
    Berdasarkan rumusan masalah di atas, maka tujuan penelitian yang hendak dicapai adalah :
    1.Untuk mengetahui prilaku konsumen dalam pembelian helm merk KYT dilihat dari harga, selera, kualitas, harga jual kembali, prestise dan promosi.
    2.Untuk mengetahui factor yang paling dominan mempengaruhi prilaku konsumen dalam pembelian helm merk KYT.

    D.Manfaat Penelitian

    Manfaat yang diharapkan dari penelitian ini adalah sebagai berikut:

    1.Penelitian ini diharapkan menjadi bahan pertimbangan dan masukan bagi perusahaan dalam menetapkan kebijakan dan strategi di bidang pemasaran untuk mengembangkan usaha bisnis mereka.
    2.Diharapkan dapat menjadi bahan acuan bagi penelitian selanjutnya.

    BAB II
    TINJAUAN PUSTAKA
    Landasan Teori

    1.Pengertian Pemasaran
    Sehubungan dengan permasalahan yang terdapat dalam penelitian ini maka diperlukan adanya teori-teori atau konsep-konsep yang memerlukan penjelasan. Dalam benyak perusahaan dewasa ini, pemasaran memegang peranan sebagai suatu faktor penting untuk tetap bertahan menjalankan usaha dan bergelut dalam dunia persaingan. Pemasaran merupakan factor vital sebagai strategi pesrusahaan dalam menjalankan usahanya, yang terutama berhubungan dengan konsumen. Kata pemasaran sendiri berasal dari kata pasar, atau bias juga diartikan dengan mekanisme yang mempertemukan permintaan dan penawaran.
    Menurut Kotler ( 2002 : 9 ) “Pemasaran adalah proses social yang didalamnyaa individu dan kelompok mendapatkan apa yang meraka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produks yang bernilai dengan pihak lain”.
    Menurut Stanton ( 1996 : 6 ) “Pemasaran adalah suatu system keseluruhan dari kegiatan-kegiatan usaha yang ditujukan untuk merencanakan, menentukan harga, mempromosikan, mendistribusikan barang dan jasa yang dapat memuaskan kebutuhan baik kepada pembeli yang ada meupun pembeli potensial”.
    Menurut Lamb, Hair, Me Daniel ( 2001 : 6 ) “Pemasaran adalah suatu proses perencanaan dan menjalankan konsep, harga, promosi, dan sejumlah ide, barang, dan jasa untuk menciptakan pertukaran yang mampu memuaskan tujuan individu dan organisasi”.
    Dari ketiga definisi diatas dapat ditarik kesimpulan bahwa pada dasarnya pemasaran bukan hanya kegiatan menjual barang maupun jasa tetapi juga meliputi kegiatan untuk memenuhi keinginan dan kebutuhan dengan berusaha mempengaruhi konsumen untuk bersedia membeli barang dan jasa perusahaan melalui penciptaan, penawaran, dan pertukaran produk yang bernilai. Hal ini sangat penting bagi manajer pemasaran untuk memahami tingkah laku konsumen tersebut. Sehingga perusahaan dapat mengembangkan, menentukan harga, mempromosikan, dan mendistribusikan produk secara lebih baik. Dengan mempelajari prilaku konsumen, manajer akan mengetahui kesempatan, mengidentifikasi, serta menentukan segmentasi pasar secara tepat dan akurat.

    2.Prilaku Konsumen
    Menurut Swasta ( 1992 : 9 ) “Prilaku konsumen dapat didefinisikan sebagai kegiatan-kegiatan individu-individu yang secara langsung terlibat dalam memdapatkan termasuk mempergunakan barang-barang dan jasa, keputusan pada persiapan dan penentuan kegiatan-kegiatan tersebut”.
    Menurut Peter J. Paul dan jerry C. Olson ( 2000 : 6 ) “Prilaku konsumen merupakan interaksi dinamis antara pengaruh dan kondisi prilaku dan kejadian di sekitar lingkungan di mana manusia melakukan aspek pertukaran dalam kehidupan mereka”.
    Dari dua jenis definissi di atas dilihat ada dua hal penting dari prilaku konsumen yaitu proses pengembalian keputusan dan kegiatan fisik yang semuanya ini melibatkan individu dalam menilai, mendapatlkan dan mempergunakan barang-barang dan jasa secara ekonomis. Dengan kata lain prilaku konsumen adalah ilmu yang mempelajari tingkah laku konsumen dalam arti tindakan-tindakan yang dilakukan untuk membeli suatu barang atau jasa tertentu.

    3.Faktor-faktor Yang Mempengaruhi Prilaku Pembelian Konsumen
    Menurut Kotler ( 2002 : 183 ) Faktor-faktor yang mempengaruhi prilaku pembelian konsumen yaitu :
    a.Faktor Kebudayaan
    Kebudayaan mempunyai penaruh paling luas dan mendalam terhadap prilaku konsumen. Terdiri dari budaya, sub budaya, dan kelas social. Budaya yang merupakan karakter paling penting dari suatu social yang membedakannya dari kelompok budaya lain menjadi penentu dan keinginan dan prilaku yang paling mendasar. Masing-masing budaya terdiri dari sub budaya yang memberikan lebih banyak ciri-ciri dan sosialisasi.Sub budaya adalah suatu kelompok homogeny atas sejumlah orang yang terbagi menjadi beberapa bagian dari keseluruhan suatu budaya. Masyarakat dalam suatu budaya dan sub budaya sesungguhnya terbagi dalam strata atau kelas social. Kelas social merupakan sekelompok orang yang sama-sama mempertimbangkan secara dekat persamaan diantara mereka sendiri.

    b.Faktor Sosial
    Pada umumnya konsumen sering meminta pendapat dari orang sekitas dan lingkungannya tentang produk apa yang harus dibeli. Karena itulah lingkungan sosial memberikan pengaruh terhadap prilaku konsumen. Faktor Sosial terdiri dari 3 bagian, yaitu : kelompok acuan, keluarga, dan peran. Kelompok acuan adalah semua kelompok yang memilki pengaruh langsung terhadap sikap / prilaku seseorang. Dengan pendapat yang diperoleh dari suatu kelompok maka konsumen dapat membuat keputusan konsumsi. Keluarga sebagai organisasi pembelian konsumen yang paling penting juga berpengaruh secara langsung terhadap keputusan seseorang dalam membeli barang sehari-hari. Sedangkan peran meliputi kegiatan yang diharapkan akan dilakukan seseorang. Suatu produk atau merk dapat menggambarkan peran dan status pamakainya.

    c.Faktor Pribadi
    Mulai dari bayi hingga dewasa dan menjadi tua, manusia selalu membutuhkan barang dan jasa. Pilihan barang yang dibeli secara otomatis dipengaruhi oleh keadaan ekonomi dan gaya hidup yang bersangkutan. Gaya hidup adalah cara hidup seseorang yang terlihat melalui aktivitas sehari-hari, minat dan pendapat seseorang. Seseorang dengan pendapatan yang tinggi dan gaya hidup mewah tentunya akan menentukan pilihan pada barang dan jasa yang berkualitas. Selain itu kepribadian dan konsep diri juga mempengaruhi pilihan produk. Konsep diri adalah bagaimana konsumen mempresepsikan diri mereka sendiri, yang meliputi sikap, persepsi, keyakinan, dan evaluasi diri. Karena sangat berguna dalam menganalisis prilaku sonsumen sehingga banyak perusahaan menggunakan konsep yang berhubungan dengan kepribadian seseorang.

    d.Faktor Psikologis
    Sikap pembelian psikologis dipengaruhi oleh empat facktor psikologis utama, yaitu : motivasi, persepsi, pembelajaran dan kepercayaan. Motivasi merupakan kebutuhan yang mendorong seseorang dalam melakukan sesuatu sesuai dengan tujuan yang ingin dicapai. Melalui motivasi proses pengamatan dan belajar seseorang memperoleh kepercayaan terhadap suatu produk yang secara otomatis mempengaruhi prilaku pembelian konsumen. Para konsumen mengembangkan beberapa kenyakinan mengenai ciri-ciri dari suatu produk dan selanjutnya akan membentuk suatu sikap konsumen terhadap produk tersebut.

    4.Faktor Pribadi
    Menurut Kotler ( 2002 : 204 ) tujuan pemasaran adalah memenuhi dan memuaskan kebutuhan serta keinginan pelanggan yang menjadi sasaran. Pada bidang prilaku konsumen ini mempelajari bagaimana individu, kelompok, dan organisasi memilih, membeli, memakai, dan membuang barang , jasa, gagasan atau pengalaman dalam rangka memuasakan kebutuhan dan hasrat mereka. Para perusahaan yang cermat melakukan riset atau Quesioner atas riset atas proses keputusan pembelian yang ada dalam jenis produk mereka. Ketika membuat keputusan untuk membeli suatu produk, konsumen melewati tahap-tahap sebagai berikut :

    a. Pengenalan Masalah
    Proses pembelian dimulai saat pembeli mengenali sebuah masalah atau kebutuhan. Pembeli merasakan perbedaan antara keadaan aktualnya dengan keadaan yang diinginkannya. Kebutuhan umum seseorang seperti lapar, haus, saat mencapai titik tertentu dapat menjadi sebuah dorongan. Kebutuhan juga dapat ditimbulkan oleh rangsangan eksternal seperti ketika seseorang melihat iklan mobil dan ingin membelinya. Dengan mengumpulkan informasi dari sejumlah konsumen, pemasar dapat menidentifikasi rangsangan yang paling sering membengkitkan minat akan suatu jenis produk. Pemasar kemudian dapat membangkitkan strategi pemasaran yang memicu minat konsumen.

    b.Pencarian Informasi
    Saat seseorang mulai menyadari kebutuhannya, maka pilihan produk dan merk harus diidentifikasi untuk memenuhi kebutuhanya. Dalam mencari berbagai alternative pilihan untuk memuaskan kebutuhan, seorang konsumen dipengaruhi oleh faktor-faktor seperti beberapa banyak biaya waktu, berapa banyak informasi dari masa alalu dan sumber-sumber lain yang sudah dimiliki oleh konsumen. Yang menjadi minat utama pemasar adalah sumber-sumber informasi utama yang menjadi acuan konsumen dan pengaruh relative dari tiap sumber tersebut terhadap kepuasan pembelian selanjutnya. Sewcara umum konsumen mendapatkan informasi tentang suatu produk dari sumber komersial yaitu sumber yang didominasi oleh pemasar.

    c. Evaluasi Alternatif
    Jika samua alternative yang wajar telah diidentifikasikan, konsumen harus mengevaluasinya satu per satu sebagai persiapan untuk mengadakan pembelian. Kriteria evaluasi yang dipakai konsumen mencakup pengalaman masa lalu dan sikap terhadap aneka merk. Konsumen juga mendengarkan tanggapan-tanggapan keluarga dan kelompok lain. Beberapa konsep dasar akan dapat membantu pemasar dalam memahami proses evaluasi konsumen. Pertama, konsumen berusaha memenuhi suatu kebutuhan. Kedua, konsumen mencari manfaat tertentu dari suatu produk. Ketiga, konsumen memandang setiap produk sebagai sekumpulan atribut dengan kemampuan yang berbeda-beda dalam memberikan manfaat yang dicari untuk memuasakan kebutuhan.

    d.Keputusan Pembelian
    Setelah mencari dan mengvaluasi berbagai alternative untuk memenuhi kebutuhan, konsumen pada titik tertentu harus memutuskan antara membeli atau tidak membeli, jika keputusan yang diambil adalah membeli, konsumen harus membuat rangkaian keputusan yang menyangkut merk, harga, tempat penjualan, warna, dan lain-lain.

    e.Prilaku Pasca Pembelian
    Saat membeli suatu produk,bagi seorang konsumen akan mengalami tingkat kepuasan dan ketidakpuasan tertentu. Perasaan konsumen setelah malakukan pembelian dapat mempengaruhi pembelian ulang dan juga ditambah dengan apa yang dikatakan oleh konsumen kepada teman atau kerabat tentang produk tersebut.Biasanya konsumen akan mengalami kecemasan purnabeli,kecemasan ini disebut disonasi kognitif purnabeli yang terjadi karena setiap alternative yang dihadapi konsumen memiliki kelebihan dan kekurangan.
    Penelitian sebelumnya.
    KERANGKA FIKIRAN

    Faktor-faktor yang dapat mempengaruhi tingkat kepuasan pelanggan helm merk KYT di Jambi

    Tanggapan terhadap Pelanggan

    Tingkat Kepuasan Pelanggan Helm Merk KYT di Jambi
    Dari hasil penelitian diketahui bahwa variabel bebas seperti harga, kahandalan system, vga card, tampilan layar,kelengkapan multi media, pelayanan purna jual berpengaruh secara simultan terhadap keputusan konsumen dalam pembelian computer pada UD Mikrocom.Persamaan penelitian ini dengan penelitain penulis adalah sama-sama menganalisis tentang prilaku konsumen, sedangkan perbedaannya adalah pada objek penelitiannya.

    Hipotesis Penelitian

    a.Hipotesis I
    Ho : Duduga factor-faktor seperti harga, selera, kualitas,harga jual kembali, prestise dan promosi, secara simultan tidak berpengaruh terhadap prilaku konsumen dalam pembelian hel merk KYT.
    Ha : Duduga factor-faktor seperti harga, selera, kualitas,harga jual kembali, prestise dan promosi, secara simultan berpengaruh terhadap prilaku konsumen dalam pembelian hel merk KYT.

    b.Hipotesis II
    Ho : Diduga factor kualitas tidak mempunyai pengaruh dominan terhadap prilaku konsumen dalam pembelian helm merk KYT pada mahasiswa Fakultas Ekonomi UNJA.
    Ha : Diduga factor kualitas mempunyai pengaruh dominan terhadap prilaku konsumen dalam pembelian helm merk KYT pada mahasiswa Fakultas Ekonomi UNJA.

    Dalles, daftar pustakamu mana. Seharusnya diunggah sesuai dg penugasan pada saat kita kuliah.

    Komentar oleh johannessimatupang | Januari 18, 2012 | Balas

  135. Maaf pak Jo, proposal telah saya kirim ke email bapak, mohon masukannya pak. Trims.

    Komentar oleh Priskila Mutiara Sembiring | Januari 19, 2012 | Balas

  136. Siang pak,
    Pak ini perbaikan saya,yang bapak minta ada penjelasan faktor situasionalnya.

    NAMA : FERRY ANGRIAWAN
    NIM : ERC1B009032
    PROPOSAL TENTATIF

    BAB I

    I.I. Latar Belakang
    Sebagai salah satu Negara beriklim tropis, yang memiliki dua iklim setiap tahunnya. Indonesia mengalami musim kemarau dan musim hujan,tetapi pada saat sekarang ini akibat dari pemanasan global mengakibatkan terkadan iklim di Indonesia tidak menentu,kapan terjadinya musim hujan dan musim kemarau.
    Karena akibat tidak menentunya iklim di Indonesia saat ini menimbulkan beberapa faktor yang terjadi pada sebagian masyarakat di Indonesia, contohnya terjadi pada kesehatan kulit. Mulai dari kulit yang kering,mengelupas,dan sebagainya.
    Untuk mengatasi masalah – masalah kulit yang terjadi akibat dari perubahan iklim yang tidak menentu dari pemanasan global. Masyarakat Indonesia membutuhkan sabun mandi ayang mampu melindungi dari factor situasi itu dalam beraktivitas sehari – hari,terutama bagi para pria yang sebagian besar aktivitas kesehariannya dilakukan di luar ruangan dan berada pada keadaan cuaca yang extreme.

    Oleh karena itu faktor situasional, salah satu yang perlu diperhatikan dalam pemasaran. Menurut Kotler, (2001) faktor-faktor yang mempengaruhi perilaku konsumen adalah kebudayaan, faktor sosial, pribadi, psikologis. Sebagian faktor-faktor tersebut tidak diperhatikan oleh pemasar tetapi sebenarnya harus diperhitungkan untuk mengetahui seberapa jauh faktor-faktor perilaku konsumen tersebut mempengaruhi pembelian konsumen”.

    Faktor situasional merupakan faktor yang dpat mempengaruhi pengambilan keputusan seseorang,yang berdasarkan hal yang terjadi,seperti cuaca,iklim,atau sesuatu yang populer saat itu.
    Dengan situasi keadaan ektrem saat ini Sebab itu sekarang ini banyak sekali terdapat produk sabun mandi berbagai macam merek,yang ditawarkan perusahaan kepada konsumen. Produk itu seperti, lifeboys, biore shower mens,nivea for mens,dan GATSBY SHOWER GEL. Dimana masing – masing merek tersebut saling berusaha untuk membuat produk mereka lebih unggul dari merek lain. Seperti produk dari PT.mandom.tbk, Yang memproduksi GATSBY shower gel yang memiliki cirri khusus yang dapat menarik minat dan mempengaruhi konsumen dalam mengambil keutusan pembelian.karena Menurut Kotler ( 2002 : 9 ) “Pemasaran adalah proses social yang didalamnyaa individu dan kelompok mendapatkan apa yang meraka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produks yang bernilai dengan pihak lain”.

    GATSBY shower gel menjadi pilihan konsumen pria dikota jambi, dan khususnya para fotogarafer di grup pasukan jepret jambi, karena aktivitas fotografer banyak dilakukan di udara panas dan kadng secara ektrem menjadi hujan. Karena GATSBY memiliki kandungan khusus untuk pria yaitu terdapat DOUBLE DEO Protectioan yang mampumembunuh bakteri penyebab bau badan dan MENTHOL menjaga dan menyegarkan kulit dalam kondisi cuaca yang ektrem.
    Itulah hal yang duharapkan mampu menarik perhatian konsumen dan memahami prilaku konsumen dalam pengambilan keputusan ,untuk mencoba memenuhi kebutuhan, karena Dalam memahami prilaku konsumen tentu tidak mudah karena konsumen mempunyai sifat yang berbeda-beda sebagaimana dari kebutuhan manusia yang tidak terbatas disamping dipengaruhi oleh kondisi eksternal dan internal lainnya yang berakibat langsung terhadap prilaku konsumen. Faktor eksternal yang dimaksud meliputi kebudayaan, sub budaya,kelas social,kelompok social, kelompok referensi, dan keluarga. Sedangkan factor internal adalah factor yang ada pada diri konsumen itu sendiri (psikologis) yang meliputi: belajar, kepribadian, dan konsep diri,serta sikap (Stanton,1996:155).

    Karena itulah Gatsby shower gel telah menjadi tuntutan Para pria , khususnya para fotografer dikota jambi, melihat keadaan inilah penulis sangat tertarik untuk melakukan penelitian dengan judul “ ANALISIS FAKTOR SITUASIONAL TERHADAP PEMBELIAN GATSBY SHOWER GEL DIKOTA JAMBI “.

    1.2. Rumusan Masalah
    Beradasarkan latar belakang masalah yang telah dikemukakan , maka dapat di indentifikasi beberapa hal sebagai berikut :
    Tidak menentunya cuaca di Indonesia ,karena disebabkan factor situasional dari dampak pemanasan global. Pemanasan global banyak menimbulkan efek negatif , bagi perubahan iklim yang tidak menentu di Indonesia. Salah satunya pada dunia kesehatan,yaitu kesehatan kulit, Oleh karena itu sabun mandi merupakan pelindung kesehatan dari cuaca extreme. Dan Gatsby shower gel merupakan salah satu pilihan dari berbagai merek produk lain bagi para fotografer dikota jambi.
    Sehingga berdasarkan uraian diatas maka permasalahan dapat dikemukakan sebagai berikut :
    Apakah factor situasional seperti cuaca mempengaruhi prilaku konsumen dan memutuskan membeli produk ?
    Apakah faktor situasional menjadi suatu factor yang dominan dalam pengambilan keputusan ?

    1.3. Tujuan penelitian
    Berdasarkan rumusan masalah masalah diatas , Tujuan penelitianyang hendak dicapai adalah :
    Untuk mengetahi apakah factor situasional dapat mempengaruhi konsumen dalam mengembil keputusan pembelian Gatsby shower gel.
    Untuk mengetahui apakah factor situasional cuaca mempunyai pengaruh dominan dalam konsumen memgambil keputusan pembelian Gatsby shower gel.

    1.4. Manfaat penelitian
    Bagi Perusahaan
    Penelitia ini diharapkan jadi pertimbangan dan masukan bagi perusahaan dalam menetapkan kebijakan strategi dapat dipertimbangankan dari factor situasional unuk mengembangkan usaha mereka,sesuai dengana apa yang dibutuhkan konsumen.
    Bagi pihak lain
    Penelitian ini dapat menjadi pengetahuan tentang factor situasi dalam pemasaran dan meningkatkan pengetahuan informasi ,masyarakat tentang produk Gatsby shower gel . Dan daoat sebagai acuan bagi penulis lain untuk penelitian selanjutnya.
    Bagi penulis
    Dengan adanya penelitian ini, penulis dapat menerapkan teori – teori yang telah di berikan selama perkuliahan,dapat pula mengetahui hasil penelitian dan ilmu dari penelitian tersebut. Dan dapat diterapkan secara baik dan benar.

    BAB II
    METODE PENELITIAN

    2.1. Lokasi penelitian

    Penelitian ini mengambil lokasi pada basecamp grup fotogrefer pasukan jepret jambi (PJJ) . Alamat villa kenali permai blok i 1 no 11. Mayang mangurai simpang 3 sipin, JAMBI 36126.

    2.2.Sampel penelitian
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan dan, waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 50 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat.

    2.3. Jenis pengumpulan data
    1.Jenis Data
    Jenis data dalam penelitian ini berupa :
    a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, skema, dan gambar, sepertu literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
    b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).
    2.Sumber Data
    Sumber data dalam penelitian ini berupa :
    a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.
    b.Data Sekunder, yaitu data yng diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari situasi-situasi internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.
    2.4 Teknik Pengumpulan Data

    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    a.Interview, yaitu suatu metode pengumpulan data dengan cara mengadakan wawancara langsung dengan responden dengan bantuan daftar pertanyaan untuk mengumpulkan data primer.
    b.Kuesioner, yaitu suatu teknik pengumpulan data yang dilakukan dengan cara memberikan seperangkat pertanyaan atau pertanyaan tertulis pada responden untuk menjawab.

    2.5 Variabel penelitian

    Variabel yang akan digunakan dalam penelitian ini adalah :
    1.VAriabel terikat (Y): Faktor situasional keadaan cuaca yang mempengaruhi dalam pembelian GATSBY shower gel
    2.Variabel bebas (X) : kebutuhan konsumen, keputusan pembelian,factor dominan pembelian.
    Untuk mengetahui hasil tanggapan responden terhadap variabel-veriabel penelitian maka digunakan data interval dengan skala 0-10. Sedangkan untuk mengetahui pengukuran dan interpretasi data, maka data interval dibagi menjadi 5 (lima) skor interval sebagai berikut :
    0 ≤ 2 Skor 1
    2,1 ≤ 4 Skor 2
    4,1 ≤ 6 Skor 3
    6,1 ≤ 8 Skor 4
    8,1 ≤ 10 Skor 5

    2.6 Definisi Operasional Variabel
    1.Kebutuhan konsumen (X1)
    Melihat tanggapan konsumen mengenai variable kebutuhan maka lebih menarik perhatian adalah bagaimana cara agar konsumen dapat memerlukan barang tersebut,karena faktor situasional.
    2. Keputusan pembelian.
    Gambaran produk GATSBY shower gel yang diinginkan konsumen,dalam memberikan kepuasan. Indikatornya adalah

    X1. Kandungan yang ditawarkan pada produk GATSBY
    Penilaian konsumen untuk melihat kandungan yang terdapat pada produk yang mampu untuk menjaga kulit dari cuaca extreme.
    X2. Penampilan kemasan
    Penilaian konsumen terhadap penilaian kemasan yang unik dan mudah disimpan dibandingkan produk lain.
    X3. Kelebihan yang ditawarkan
    Penilaian konsumen dalam kelebihan yang ditawarkna produk dilihat dari manfaat kandunngan double deo untuk melindungi kulit.

    DAFTAR PUSTAKA

    Stanton, William J.1996. Prinsip Pemasaran (terjemahan). Edisi 7,jilid 1.Erlangga. Jakarta.
    Arikunto,Suharsimi.2002. Prosedur Penelitian.Edisi Revisi V.PT.Rineka Cipta.Jakarta.
    Kotler, Philip.2002.Manajemen Pemasaran (terjemahan).Edisi Millenium, jilid 1.PT. Prenhallindo. Jakarta.
    mandom.co.id/product.php?lang=&topcat=1000071&subTopID=1000080&parentcat=1000086
    Majour.maranatha.edu/index.php/jurnal-manajemen/article/view/168pdf
    Syadiashare.com/iklim-di-indonesia-html

    Komentar oleh ferry angriawan | Januari 19, 2012 | Balas

  137. NAMA : MARISSA HUSNA
    NIM : ERC1B009015
    PROPOSAL TENTATIF

    Analisis penanganan keluhan gangguan PT. PLN cabang kota Jambi

    BAB I
    PENDAHULUAN

    1.1 Latar Belakang Penelitian

    Perubahan dalam dunia usaha yang semakin cepat mengharuskan perusahaan untuk merespon yang terjadi, masalah pokok yang dihadapi prusahaaan -perusahaan saat ini adalah bagaimana perusahaan tersebut menarik pelanggan dan mempertahankannya agar perusahaan tersebut dapat bertahan dan berkembang. Perubahan teknologi informasi yang berkembang cepat, megharuskan berbagai perusahaan dapat memberikan solusi yang tepat dan cepat sesuai kebutuhan/keinginan pelanggan, sehingga pelanggan puas dan akan bertahan berlangganan. Untuk menjawab masalah tersebut, pemasaran merupakan salah satu kegiatan pokok yang dilakukan oleh perusahaan untuk mempertahankan
    kelangsungan hidupnya. Dalam pemasaran modern, paradigma pemasaran telah bergeser, tidak hanya menciptakan transaksi untuk mencapai keberhasilan pemasaran tetapi perusahaan juga harus menjalin hubungan dengan pelanggan dalam waktu yang panjang.
    Sebagai perusahaan yang bergerak di bidang pendistribusian/penjualan energi listrik PT. PLN (Persero) dalam meraih keuntungan tidak lagi mengandalkan pada volume penjualan saja.
    Kebutuhan pelanggan perlu diidentifikasi secara jelas, sebagai bagian dari pengembangan produk. Tujuan pendekatan ini adalah untuk melampaui harapan pelanggan dan bukan sekedar memenuhinya. Oleh karena itu diperlukan informasi yang akurat apa kebutuhan dan keinginan pelanggan atas dasar barang atau jasa yang dihasilkan perusahaan. Dengan demikian perusahaan dapat memahami dengan baik perilaku pelanggan pada sasarannya, serta dapat menyusun strategi dan program yang tepat dalam rangka memanfaatkan peluang yang ada, menjalin hubungan dengan setiap pelanggan dan mampu mengungguli pesaingnya.
    Perusahaaan yang ingin berkembang dan mendapatkan keunggulan kompetitif harus dapat memberikan produk berupa barang atau jasa berkualitas dengan harga yang murah, penyerahan lebih cepat, dan pelayanan yang baik kepada para pelanggan daripada pesaingnya. Untuk memenuhi kepuasan pelanggan pada industri jasa, kualitas pelayanan sangat penting dikelola perusahaan dengan baik.
    Kualitas pelayanan merupakan tingkat keunggulan yang diharapkan dan pengendalian atas tingkat keunggulan tersebut untuk memenuhi harapan pelanggan (Wyckof, 1993; dalam Sulistyo, 1999).
    Dalam menciptakan kepuasan pelanggan , perusahaan harus dapat meningkatkan nilai pelanggan. Nilai pelanggan dapat diciptakan melalui kualitas kualitas pelayanan yang diberikan perusahaan kepada para pelanggannya.
    Semakin baik kualitas pelayanan, akan semakin tinggi pula nilai pelanggan terhadap perusahaan tersebut. Tingginya kualitas pelayanan juga tidak lepas dari dukungan internal perusahaan, terutama dukungan dukungan dari sumber daya manusia.
    Dalam meningkatkan nilai pelanggan perusahaan juga tidak bisa melupakan jenis dan mutu produknya. Perusahaan yang jenis produknya sangat inovatif, bermutu tinggi, harga bersaing, sehingga mampu bersaing dengan produk lain yang sejenis, akan dapat menarik lebih banyak pelanggan. Semakin inovatif suatu produk, sehingga dapat memenuhi segala kebutuhan pelanggan, maka akan semakin tinggi pula kepuasan pelanggan.
    PT PLN (Persero) sebagai BUMN yang besar yang menjalankan usaha distribusi energi listrik ke pelanggan dituntut untuk menjaga citra perusahaan jangan sampai terjadi implikasi negatif yang dapat mengurangi kepercayaan pelanggan kepada perusahaan, yang akhirnya akan mengurangi citra perusahaan dimata pelanggannya. Sebagai perusahaan yang sekaligus menyediakan produk / jasa, PT. PLN (Persero) harus dapat memberikan kualitas pelayanan yang prima, yaitu pelayanan yang sangat baik dan melampaui harapan pelanggan sehingga dapat memuaskan para pelanggannya secara lebih baik, yang pada gilirannya dapat menumbuhkan loyalitas pelanggan, sehingga terjadi pembelian ulang.
    Selain memberikan pelayanan yang ekselen (prima), PT PLN (Persero) menerapkan upaya-upaya untuk mencapai nilai pelanggan yang berkualitas, kepuasan pelanggan dan loyalitas pelanggan untuk mencapai keuntungan perusahaan.
    Disisi lain kualitas pelayanan merupakan salah satu faktor kunci bagi keberhasilan PLN. Tidak ada yang lebih penting selain menciptakan kepuasan pelanggan PLN melalui pelayanan sebagai salah satu komitmen. Jika pelayanan yang diberikan kepada pelanggan PLN semakin baik akan mempengaruhi kepuasan pelanggan.
    PT. PLN (Persero) sebagai salah satu perusahaan penyedia energi dan mendistribusikan (atau menjual) pada pelanggan, walaupun tidak ada pesaingnya (monopoli) ditingkat hilir atau retail hingga ke tangan pelanggan, tapi menjadi suatu kewajiban bagi perusahaan untuk memberikan nilai pelanggan (customer value), relatif murah harganya (percieved price) dan meningkatkan citra perusahaan (corporate image) serta terus meningkatkan kualitas pelayanan (service quality) yang maksimal. Apabila empat variabel tersebut dilaksanakan dengan baik, maka akan mempengaruhi kepuasan pelanggan (customer satisfaction) listrik.
    PT. PLN (Persero) Unit Pelayanan dalam melaksanakan/menjalankan bisnis inti atau bisnis lain yang terkait harus mematuhi aturan atau ketentuan yang telah digariskan oleh PT. PLN (Persero). Dengan demikian bisnis yang dijalankan tersebut benar-benar terukur, apakah bisnis (kinerja/prestasi kerja) tersebut berhasi atau tidak tercapai ?

    1.2 Rumusan Masalah

    Kualitas pelayanan memiliki hubungan yang erat dengan kepuasan
    pelanggan. Kepuasan pelanggan akan timbul setelah seseorang mengalami
    pengalaman dengan kualitas pelayanan yang diberikan oleh penyedia jasa dalam penanganan keluhan.
    Di PT PLN (Persero) Unit Pelayanan masih dijumpai adanya perbedaan (gap) mengenai kepuasan pelanggan antara yang diharapkan pelanggan dengan realita kinerja pelayanan yang diberikan oleh perusahaan.
    Hal ini dapat terbukti dengan terus meningkatnya jumlah keluhan dari pelanggan yang berkaitan dengan kualitas pelayanan yang diberikan oleh PT.PLN (persero) unit pelayanan kepada pelanggan yang berhubungan dengan waktu pemadaman listrik yang relative lama dan seriingnya terjadi pemadaman.
    Berdasarkan latar belakang masalah yang telah dikemukakan diatas dapat dirumuskan masalah sebagai berikut:
    1. Bagaimana tingkat harapan pelanggan dan kinerja Nilai Pelanggan (Customer
    Value) PT PLN (Persero) Unit Pelayanan bagi pelanggan ?
    2. Bagaimana tingkat harapan pelanggan dan kinerja Persepsi Harga (Perceived
    Price) PT PLN (Persero) Unit Pelayanan ?
    3. Bagaimana tingkat harapan pelanggan dan kinerja Citra Perusahaan
    (Corporate Image) PT PLN (Persero) Unit Pelayanan ?
    4. Bagaimana tingkat harapan pelanggan dan kinerja Kualitas Pelayanan (Service
    quality) PT PLN (Persero) pada penanganan keluhan gangguan bagi pelanggan ?

    1.3 Tujuan Penelitian

    Dengan dirumuskannya sebuah penelitian, maka untuk dapat menjawab masalah tersebut ditetapkan beberapa tujuan penelitian, yaitu :
    1. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Nilai
    Pelanggan (Customer Value) PT PLN (Persero) Unit Pelayanan bagi pelanggan.
    2. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Persepsi Harga
    (Perceived Price) PT PLN (Persero) Unit Pelayanan bagi pelanggan.
    3. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Citra
    Perusahaan (Corporate Image) PT PLN (Persero) Unit Pelayanan bagi pelanggan.
    4. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Kualitas
    Pelayanan (Service quality) PT PLN (Persero) pada penanganan keluhan gangguan bagi pelanggan.

    1.4 Manfaat Penelitian.
    Manfaat penelitian ini mengembangkan ilmu pengetahuan dalam strategi khususnya dalam bidang pemasaran perusahaan.
    1. Secara praktis memberikan sumbangan informasi dan bahan masukan bagi
    perusahaan untuk menentukan langkah kebijakan yang tepat dalam usahanya
    untuk memberikan pelayanan yang sesuai dengan harapan pelanggan dan penanganan keluhan gangguan.
    2. Secara teoritis penelitian ini diharapkan dapat memberikan kontribusi dan rujukan empiris yang memperkuat teori yang menyatakan bahwa pelayanan dapat dikatakan berkualitas, apabila dapat memnuhi harapan (kepentingan) dan kebutuhan pelanggan.
    3. Hasil penelitian ini dapat menjadi inspirator bagi peneliti-peneliti lain untuk melakukan penelitian serupa pada agenda penelitian mendatang dengan menggunakan pendekatan variabel-variabel penelitian lain yang menjadi kebijakan yang dijalankan oleh perusahaan.

    BAB II
    METODE PENELITIAN

    1.1 Populasi
    Menurut Sugiyono (1999), populasi adalah wilayah generalisasi yang terdiri atas obyek/subyek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulan.
    Populasi dalam penelitian ini adalah pelanggan PT PLN (Persero) di Perumahan Beringin indah.

    1.2 Sample
    Menurut Sudarwan Danim (1997), sample adalah elemen-elemen populasi yang dipilih atas dasar kemampuan meakilinya.
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 15 responden yang terdapat dalam populasi tersebut. sampel yang digunakan dalam penelitian ini dilakukan dengan menyebarkan kuesioner ke seluruh pelanggan PT PLN (Persero).

    DAFTAR PUSTAKA

    http://eprints.undip.ac.id/24065/

    google.com

    http://tatangmanguny.wordpress.com/2009/06/25/sampel-sampling-dan-populasi-penelitian-1/

    Beringin indah itu kecamatan atau kelurahan. Usahakan sampel satu kecamatan.

    Komentar oleh MARISSA HUSNA | Januari 19, 2012 | Balas

  138. “HASIL PERBAIKAN”
    nama : MARIATY SITOMPUL
    NIM: C1B009015
    manajemen A

    ANALISIS PENGARUH FAKTOR PSIKOLOGIS TERHADAP KEPUTUSAN KONSUMEN MEMILIH JASA PENDIDIKAN BAHASA INGGRIS DI LBPP-LIA-JAMBI

    BAB I
    PENDAHULUAN

    1. latar Belakang Penelitian
    Sudah lama penguasaan bahasa Inggris menjadi pengetahuan yang perlu dipelajari oleh orang Indonesia. Mulai dari tahun 60’an hingga sekarang, pelajaran bahasa Inggris menjadi subyek yang tidak kalah gengsinya dari pelajaran lain seperti Matematika dan IPA. Besarnya kebutuhan untuk belajar bahasa Inggris telah membuat pengetahuan ini menjadi sebuah komoditas bisnis tersendiri. Lembaga pengajaran bahasa Inggris swasta pun bermunculan seperti LIA, Jakarta College, Oxford, BBC, IEC, EF, TBI dan lain-lainnya. Orang tua kemudian seperti berlomba-lomba untuk mengirimkan anak mereka untuk mengikuti kursus di salah satu lembaga pengajaran bahasa Inggris yang sudah disebutkan di atas. Jika dulu anak Indonesia baru mempelajari bahasa Inggris pada tingkat SMA, sekarang mereka memulainya pada tingkat yang lebih dini, SD, dan kalau perlu TK. Oleh karena orang Indonesia masih menganut budaya Timur yang agak totok, anak tidak boleh protes apabila diharuskan ayah ibunya untuk mempelajari bahasa Inggris. Lucunya, banyak orang tua yang mengharuskan anaknya mengikuti kursus bahasa asing yang satu ini tanpa mampu memberikan satu alasan yang jelas mengapa bahasa Inggris itu penting bagi mereka.
    Lembaga Bahasa dan Pendidikan Professional LBPP-LIA-Jambi merupakan salah satu lembaga pengajaran bahasa inggris ternama di jambi, tidak heran bila konsumen tetap memilih LIA sebagai lembaga yang bergerak dalam bidang jasa pendidikan walaupun dengan biaya yang lebih mahal dibandingkan dengan lembaga lain. Perilaku konsumen dalam mengambil keputusan tersebut dapat dipengaruhi oleh factor kultur, social, pribadi, dan psikologis.
    Factor yang paling mempengaruhi konsumen adalah factor psikologis, psikologis konsumen dipengaruhi lewat media massa (Koran, majalah, TV, radio, internet, dan lain-lain). Dengan mengetahui factor yang mempengaruhi keputusan pembelian diharapkan dapat memberikan pelayanan jasa yang sesuai dengan harapan konsumen, sehingga keputusan pembelian dapat meningkat.
    Berdasarkan uraian diatas maka penulis sangat tertarik untuk melakukan penelitian yang berjudul “Analisis Pengaruh Faktor Psikologis Terhadap Keputusan Konsumen Memilih Jasa Pendidikan Bahasa Inggris Di LBPP-LIA-JAMBI.”

    2. Rumusan Masalah
    Sikap pembelian psikologis dipengaruhi oleh empat factor utama, yaitu : motivasi, persepsi, pembelajaran dan kepercayaan dan sikap. Motivasi merupakan kebutuhan yang mendorong seseorang dalam melakukan sesuatu sesuai dengan tujuan yang dicapai. Melalui motivasi proses pengamatan dan belajar seseorang memperoleh kepercayaan terhadap suatu produk yang secara otomatis mempengaruhi perilaku pembelian konsumen.
    Keputusan Pemilihan jasa pendidikan LIA bagi para konsumen dapat dilakukan penelitian terlebih dahulu, sehingga dapat menilai keinginan dan perilakunya. Mengingat LIA sebagai lembaga ternama di Jambi dengan biaya yang cukup mahal namun konsumen tetap memilihnya dan semua yang telah diuraikan pada latar belakang, maka yang menjadi permasalahan adalah “Bagaimana pengaruh factor psikologis terhadap keputusan konsumen memilih jasa pendidikan bahasa inggris di LBPP-LIA-JAMBI?”

    3. Tujuan Penelitian
    1. Untuk mengetahui bagaimana pengaruh factor psikologis terhadap keputusan konsumen memilih jasa pendidikan di LBPP-LIA-JAMBI
    2. Untuk menganalisis pengaruh factor psikologis terhadap keputusan konsumen memilih jasa pendidikan di LBPP-LIA-JAMBI
    4. Manfaat Penelitian
    1. Bagi penulis: Penulis dapat mengetahui bagaimana pengaruh factor psikologis terhadap keputusan konsumen memilih jasa pendidikan di LBPP-LIA-JAMBI.
    2. Bagi LBPP-LIA-JAMBI: Dengan adanya penelitian ini diharapkan penelitian ini dapat memberikan pemikiran dan bahan pertimbangan dalam meningkatkan pelayanan jasa pendidikan sehingga LBPP-LIA-JAMBI tetap dipilih oleh konsumen.
    3. Bagi peneliti selanjutnya: Diharapkan dengan adanya penelitian ini, dapat menjadi rujukan untuk melakukan penelitian yang sama dengan factor kontijensi lainnya yang mempengaruhi

    BAB III
    METODE PENELITIAN

    A. Lokasi Penelitian
    Penelitian ini mengambil lokasi pada LBPP-LIA-JAMBI dengan alamat jln. Prof. Dr. Sri Soedewi MS, SH No.2 Telanaipura Jambi Telp/Fax. 0741-60718

    B. Populasi dan Sampel
    1. Populasi Penelitian
    Populasi dalam penlitian ini adalah siswa/siswi yang terdaftar di LBPP
    LIA-JAMBI
    2. Sampel Penelitian
    Untuk memperoleh sample yang representative dalam penelitian ini, maka digunakan teknik penarikan sample dengan menggunakan metode judgemen yang mana responden yang akan dipilih adalah orang-orang yang diperkirakan dapat menjawab semua isi kuisioner.
    Adapun yang menjadi responden sebanyak 100 orang dengan menggunakan cara kuota adalah remaja dan dewasa yang telah terdaftar sebagai siswa/siswi di LBPP-LIA-JAMBI

    3. Tinjauan Pustaka
    Defenisi
    Menurut Kotler diterjemahkan oleh Teguh (2000) adalah : “Pilihan pembelian
    seseorang dipengaruhi oleh lima faktor psikologis utama yaitu: motivasi,
    persepsi, pembelajaran, kepercayaan dan sikap”.

    Operasional Variabel
    Variabel Dimensi Defenisi Atribut Indikator Skala
    Faktor psikologis motivasi Dorongan psikologis yang mengarahkan seseorang kearah tujuan • Teman
    • Keluarga
    • Diri Sendiri
    • Informasi iklan • Fungsi dan manfaat
    • Mutu dan kualitas ordinal
    persepsi Proses dimana seseorang memilih, mengorganisasikan, mengartikan masukan informasi untuk menciptakan suatu gambaran yang berarti. • Nama/ merek
    • Lokasi • Daya tarik
    • Pandangan mengenai merk dan produk
    • Pengaruh pesan mengenai produk ordinal
    pembelajaran Proses belajar menjelaskan perubahan dalam perilaku seseorang yang timbul dari pengalaman • Informasi iklan
    • Teman
    • Keluarga
    • penjual • pengenalan
    • pemahaman
    • pengalaman ordinal
    Kepercayaan dan sikap Kepercayaan adalah suatu gagasan sesorang terhadap sesuatu. Sikap adalah kepercayaan mengenai orang, kelompok, aktifitas. • Fasilitas
    • Program
    • Tingkat
    • Jadwal belajar

    • Keyakinan terhadap produk
    • Opini atau pendapat
    • Sikap positif terhadap produk ordinal

    Komentar oleh MARIATY SITOMPUL | Januari 19, 2012 | Balas

    • pak saya sudah perbaiki “tujuan” dan “manfaatnya”
      “maksud dari batasan sampel saya belum sesuai gimana pak ? (terkait komen bpk)
      thanks pak.
      mohon komentar bpk selanjutnya….

      Komentar oleh MARIATY SITOMPUL | Januari 19, 2012 | Balas

  139. PROPOSAL TENTATIF
    Nama : Marhamah
    Nim : ERC1B009061

    “ANALISIS PENGARUH SALURAN DISTRIBUSI TERHADAP PENJUALAN KERUPUK TEMPE TAKIARI KOTA JAMBI”

    BAB I
    PENDAHULUAN
    1.1 Latar Belakang Penelitian
    Suatu Perusahaan pada umumnya mempunyai beberapa tujuan yang menjadi sebab mengapa prusahaan itu didirikan. Adapun tujuan prusahaan itu antara lain mendapatkan laba, menguasai pasar, berperan dalam kegiatan sosial dan mempertahankan diri dari persaingan. Namun tujuan tidak akan tercapai jika produk yang di tawarkan tidak laku dijual. Suatu produk baik barang maupun jasa harus dipasarkan secara efektif.
    Pemasaran merupakan salah satu fungsi operasional perusahaan di samping fungsi personalia, fungsi keuangan dan produksi yang memegang peranan penting dalam usaha pencapaian tujuan perusahaan. Begitu pentingnya pemasaran bagi peerusahaan, sehingga sering di katakana bahwa pemasaran merupakan ujung tombak bagi perusahaan dalam rangka pencapaian tujuan.
    Dalam rangka memperlancar arus barang dan jasa dari produsen ke konsumen, maka salah satu faktor dari ke empat variabel tersebut tidak boleh dilupakan. Salah satunya adalah Distribusi.
    Distribusi adalah satu dari empat variabel bauran pemasaran, pada dasarnya berarti kegiatan menempatkan produk di tempat yang mudah dan aman bagi konsumen mndapatkannya. Kata distribusi mempunyai dua arti, pertama, distribusi berarti kegiatan pemindahan produk scara fisik untuk menyampaikan produk kepada konsumen, termasuk didalam pengertian ini kegiatan pengangkutan dan penyimpanan. Arti kedua dari distribusi adalah rantai dari lembaga-lembaga dan individu-individu yang terlibat dalam kegiatan distribusi.
    Distribusi mempunyai tujuan untuk mencapai pasar tertentu dengan maksud mengatasi kesenjangan waktu, tempat, dan penelitiannya yang memisahkan barang dari mereka yang akan menggunakan barang tersebut. Walaupun suatu produk sudah tepat dan promosi pun sudah berjalan, namun produk tidak akan di beli jika tidak di tempatkan pada tempat yang tepat.
    Untuk memperlancar arus barang dan jasa dari produsen ke konsumen, maka distribusi harus dipilih secara tepat, karena itu pengaruhnya begitu besar terhadap suatu perusahaan terhadap kelancaran penjualan.
    Salah satu untuk melakukan kegiatan bauran pemasaran dalam hal ini termasuk saluran distribusinya adalah Usaha UUPKS (Unit Pengembangan Keluarga Sejahtera) Permai Kota Jambi dalam memasarkan kerupuk tempe Takiari. Usaha UUPKS Permai Kota Jambi merupakan suatu usaha kerupuk dibawah binaan Unit Usaha Pengembangan Keluarga Sejahtera Dinas Perindustrian Kota Jambi.
    Dalam memasarkan produknya home industri kerupuk tempe Takiari ini menggunakan dua saluran distribusi, yaitu : Saluran Distribusi Langsung dan Saluran Distribusi Tidak Langsung. Saluran distribusi langsung dilakukan dirumah perusahaan yang memproduksi kerupuk tempe ini, dengan melayani konsumen dari sekitar rumah yang datang langsung untuk membeli kerupuk. Saluran distribusi tidak langsung menggunakan pengecer sebagai perantaranya, berupa warung-warung, dan took-toko yang menjual kebutuhan sehari-hari.
    Pada Berbagai tingkat distribusi diperlukan upaya pengumpulan informasi untuk merencakan, mengembangkan dan menyebarkan informasi tentang produk, menemukan dan berkomunikasi dengan pembeli hal ini agar produk yang dapat dipasarkan sesuai dengan keingina pembeli.
    Volume produksi Kerupuk Tempe Takiari Usaha UUPKS Permai Kota Jambi selama lima tahun terakhir dari tahun 2006-2010 dapat dilihat pada tabel 1.1 di bawah ini :

    Tabel 1.1
    Produksi Kerupuk Tempe
    Takiari Pada Usaha UUPKS Permai Kota Jambi
    Periode Tahun 2006-2010

    Tahun Produksi Kerupuk Tempe Takiari
    (Kg)
    2006 12.480
    2007 14.040
    2008 19.656
    2009 26.520
    2010 24.336
    Sumber: Usaha UUPKS Permai Kota Jambi, Tahun 2010

    Dari tabel diatas produksi kerupuk tempe Takiari pada tahun 2006 hingga 2009 mengalami kenaikan yang cukup signifikan tetapi tahun 2010 penjualan mengalami penurunan, hal ini lah yang menjadi masalah dikarenakan produsen yang memegang usaha ini merasa tidak sanggup lagi memproduksi barang hasil produksinya sesuai target dari perusahaan tersebut dikarenakan faktor umur yang dimilikinya, sehingga tidak dapat bekerja secara maksimal. Dan juga diduga karena produk yang dihasilkan juga banyak belum diketahui oleh konsumen secara luas karena kegiatan distribusinya belum sepenuhnya dapat menjangkau pangsa pasar. Apabila hal ini terus menerus terjadi maka akan dapat mempengaruhi keberlangsungan hidup perusahaan dimasa yang akan datang.
    1.2 Rumusan Masalah
    Usaha Kerupuk Tempe Takiari ini merupakan unit usaha pengembangan keluarga sejahtera (UUPKS) yang beroperasi memperoduksi dan memasarkan produk jenis kerupuk. Produk yang dihasilkan adalah produk kerupuk tempe yang dipasarkan dengan merek “Takiari”
    Dalam memasarkan produknya Home Industri Kerupuk Tempe Takiari ini menggunakan dua salulran distribusi, Yaitu : Saluran Distribusi langsung dan Saluran Distribusi Tidak Langsung. Penyalluran dengan distribusi langsung dilakukan pengusaha yang memproduksi tempe ini dengan melayani konsumen dari sekitar rumah yang datang untuk membeli kerupuk. Penyaluran dengan distribusi tidak langsung menggunakan pengecer sebagai perantaranya, berupa warung-warung, dan took-toko yang menjual kebutuhan sehari-hari.
    Berdasarkan uraian diatas maka yang menjadi masalah dalam penelitian ini adalah :
    1. Saluran Distribusi apa yang digunakan oleh Home Produksi Kerupuk Tempe Takiari di kota Jambi?
    2. Seberapa besarnya pengaruh saluran distribusi terhadap penjualan kerupuk tempe Takiari di Kota Jambi?

    1.3 Tujuan Penelitian
    Adapun Tujuan Penelitian adalah :
    1. Untuk menganalisis pelaksanaan saluran distribusi kerupuk tempe Takiari di Kota Jambi.
    2. Untuk mengetahui besarnya pengaruh saluran distribusi terhadap penjualan kerupuk Tempe Takiari di Kota Jambi

    1.4 Manfaat Penlitian
    1. Hasil penelitian ini diharapkan dapat menjadi masukan bagi usaha UUPKS Permai Kota Jambi.
    2. Sebagai referensi untuk bahan penelitian selanjutnya yang ada hubungannya dengan masalah yang sama tapi dengan pendekatan yang berbeda.

    BAB II
    METODOLOGI PENELITIAN
    2.2.1 Populasi penelitian
    Populasi adalah Kumpulan dari individu dengan kualitas serta ciri-ciri yang telah di tetapkan menurut (Moh. Nazir,2005.271) Populasi yang diambil pada penelitian ini ialah pada pengecer –pengecer yang digunakan oleh home industry kerupuk tempe takiari ini dalam menyalurkan produk kerupuk tempenya kepada konsumen akhir
    2.2.2 Sampel penelitian
    Sampel adalah bagian dari populasi menurut (Moh. Nazir,2005.271)
    Dikarnakan jumlah populasi pada penelitian ini tidak terlalu banyak hanya 25 pengecer maka yang akan dijadikan sampel juga sebanyak itu. sampel yang digunakan dalam penelitian ini dilakukan dengan terjun kelapangan langsung atau penelitian secara langsung

    2.2.3 Jenis dan Sumber data
    a) Jenis Data
    Data sekunder, data ini diperoleh dari pihak perusahaan dalam bentuk laporan. Data yang diperoleh mengenai laporan penjualan, sejarah perusahaan, struktur organisasi, serta keadaan yang ada dalam perusahaan tersebut.
    b) Sumber Data
    Sumber data berasal dari Usaha UUPKS permai kota jambi

    2.2.4 Metode pengumpulan data
    Untuk dapat memperoleh data yang di perlukan dalam penelitian ini digunakan metod pengumpulan data sebagai berikut:
    1) Library Reseacrh(penelitian keperpustakaan)
    Penelitian yang dilakukan dengan mempelajari literatur-literatur, buku-buku dan penelitian lainnya yang ada hubungannya dengan masalah yang diteliti
    2) Field Research (penelitian lapangan)
    Penelitian yang dilakukan dengan cara langsung turun kelapangan guna memperoleh data dan informasi dari usaha UUPKS Permai kota jambi melalui tehnik sebagai berikut:
    a. Metode observasi, dalam metode ini dilakukan pengamatan langsung dengan meninjau dan mengamati hal-hal yang reverensi terhadap objek penelitian
    b. Metode interview, untuk memperoleh data dan informasi dengan melakukan wawancara kepada pihak yang berwenang pada usaha UUPKS permai kota jambi untuk mendukung pengamatan yang dilakukan

    DAFTAR PUSTAKA
    Basu Swasta, Irawan.1990.manajemen pemasaran modern,Liberty:Yogyakarta.
    Basu Swasta, Edisi I dh. 2000. Saluran Pemasaran, BPFE : Yogyakarta.
    Basu Swasta, Edisi Kedua dh. 2004 B. Azaz-Azaz Marketing,Liberty:Yogyakarta.
    Fandi Tjiptono. 2008 .pemasaran strategic,Andi :Yogyakarta.
    Stanton. 1993. Prinsip pemasaran, Edisi Tujuh, Erlangga : Jakarta.

    Marhamah sepertinya judul dan proposalmu ini baru pertama kali diusulkan.

    Komentar oleh MARHAMAH | Januari 20, 2012 | Balas

    • iya pak..trima kasih ya pak :)

      Komentar oleh MARHAMAH | Januari 21, 2012 | Balas

  140. Nama : Lidya anastasia
    NIM : ERC1B009020
    Proposal

    BAB I
    PENDAHULUAN

    1.1. Latar Belakang
    Pembangunan nasional merupakan sarana untuk mencapai tujuan nasional yaitu mencapai masyarakat adil dan makmur berdasarkan pancasila. Pada hakekatnya perusahaan yang bergerak dalam berbagai bidang usaha merupakan salah satu unit pelaksanaan dan berperan penting dalam pembangunan nasional. Peran dan partisipasi perusahaan dalam pembangunan nasional bertujuan meningkatkan dan memperlancar faktor yang diperlukan dalam pembangunan, peran dan partisipasi ini tentunya menyangkut konsekuensi bagi perusahaan-perusahaan tersebut untuk selalu menjaga pelayanan yang baik terhadap konsumen.
    Pasar merupakan faktor utama dalam perkembangan dunia usaha dewasa ini. Semakin komplek dan dalam keadaan persaingan yang semakin ketat pula. Konsumen pun semakin selektif dalam mengalokasikan pendapatannya untuk keperluan konsumsinya, sehingga para pengusaha semakin dituntut kejeliannya dalam menemukan berbagai cara untuk meningkatkan pelayanan yang ada di perusahaannya serta memberikan pelayanan purna jual dengan ketentuan perusahaan.
    Pelaksanaan usaha purna jual sangat erat hubungannya dengan proses pembelian jasa oleh konsumen karena apabila konsumen telah merasakan apa yang mereka harapkan akan tercapai kesetiaan atau loyalitas konsumen kepada perusahaan hingga kualitas pcrusahaan yang mereka rasakan benar-benar dapat memberikan kepuasan dalam diri mereka.
    Kenaikan dan penurunan penerimaan biaya purna jual yang terjadi pada dipengaruhi dengan adayan faktor yang berasal dari luar maupun dari dalam perusahaan itu sendiri. Untuk itu perusahaan yang bergerak dalam bidang jasa kualitas pelayanan menjadi sangat penting dalam kelansungan hidup perusahaan tersebut, seperti yang ditemukan Kolter (1995 ; 351) penerjemah Adi Zakaria. A. Siff bahwa kunci mempertahankan konsumen adalah kepuasan konsumen. Kepuasan konsumen akan tercapai apabila kualitas pelayanan yang diberikan sesuai dengan yang diinginkan konsumen seperti halnya kebijaksanaaan mengenai pelaksanaan pelayanan purna jual.
    Syarat yang harus dipenuhi oleh suatu perusahaan agar dapat suskes dalam persaingan adalah berusaha mencapai tujuan untuk menciptakan dan mempertahankan pelanggan. Agar tujuan tersebut tercapai maka setiap perusahaan harus berupaya menghasilkan produk yang diinginkan konsumen dengan harga yang pantas, waktu yang tepat, pelakasanaan yang baik, service yang memuaskan karena itu sudah merupakan salah satu tujuan dari pemasaran yang benar. Dengan demikian setiap perusahaan harus mampu memenuhi perilaku konsumen pada pasar sasarannya, karena kelangsungan hidup perusahan tersebut sebagai organisasi yang berusaha memenuhi kebutuhan dan keinginan para konsumen sangat tergantung pada perilaku konsumen. Melalui pemahaman perilaku konsumen, pihak manajemen perusahaan dapat menyusun strategi dan program yang tepat dalam rangka memanfaatkan peluang yang ada dan mengungguli para pesaingnya.
    Kebanyakan perusahaan mengoperasikan departemen pelayanan konsumen dengan mutu yang sangat bervariasi. Perusahaan manufaktur pada umumnya mulai dengan menjalankan departemen suku cadang dan jasa perusahaan yang memberikan pelayanan yang bermutu tinggi tidak diragukan lagi akan mengungguli pesanan yang kurang berorientasi pada pelayanan.
    Pelayanan purna jual merupakan salah satu bentuk pelayanan yang sangat penting bagi PT. Sutan Kasim Cabang Jambi service merupakan follow up bagi keberhasilan produk yang dipasarkan, dan juga meningkatnya harga mobil sehingga perusahaan lebih menekankan pada kegiatan pelayanan purna jualnya.
    Dalam kegiatan pemasaran, strategi pemasaran sangat menentukan untuk dapat bersaing dipasaran.Meningkatnya pesaing dalam memasarkan dewasa ini telah menuntut perusahaan untuk mampu bersaing dalam merebut dan menguasai pasar sebagai usaha meningkatkan penjualan.
    Dalam memasarkan kendaraan terutama yang berstatus dealer perusahaan harus menyediakan dan memberikan pelayanan purna jual. Bentuk pelayanan purna jual yang diberikan perusahaan tersebut dapat berbentuk penyediaan suku cadang asli, tenaga mekanik perbaikan dan penggantian suku cadang serta berbagai bentuk pelayanan garansi. Hal ini ditujukan kepada kepuasan konsumen dalam pembelian kendaraaan, sehingga dari konsumen sebagai pembeli dapat lebih terjamin dan juga lebih puas.
    Meningkatnya penjualan kendaraan di propinsi Jambi merupakan peluang bagi perusahaan-perusahaan yang bergerak dalam memasarkan kendaraan terutama kendaraan roda empat (mobil,. Banyaknya perusahaan sejenis yang bergerak memasarkan kendaraan bermotor di Propinsi Jambi, merupakan tantangan bagi masing-masing perusahaan dalam mempertahankan konsumen yang ada maupun mendapatkan konsumen yang baru. Keberhasilan suatu perusahaan untuk mempertahankan atau merebut konsumen tergantung kepada strategi pemasaran yang dilakukannya.
    Usaha jasa muda umumnya bernilai tinggi dalam mutu pelayanan dan kepercayaan, sehingga konsumen lebih percaya pada kata-kata yang dikeluarkan dari mulut ke mulut dari iklan pelayanan perusahaan. Menurut Parasuraman (1995 ; 25), apabila jasa yang diterima atau dirasakan sesuai dengan yang diharapkan, maka kualitas jasa dipersepsikan baik dan memuaskan, jika jasa yang diterimanya lebih rendah dari pada yang diharapkan maka kualitas dipersiapkan buruk. Hal ini berarti baik buruknya yang diharapkan maka kualitas jasa tergantung dari pada kemampuan penyedia jasa dalam memenuhi harapan konsumennya (konsumen) secara konsisten.
    Untuk kedaraan bermotor roda empat (mobil) merupakan barang yang bernilai relatif tinggi yang mana dalam pengambilan keputusan untuk pembeliannya akan memerlukan banyak pertimbangan oleh karena itu pelaksanaan usaha pelayanan purna jual ini untuk memberikan jaminan bagi kepuasan dan hal ini sangat berpengaruh pada proses pengambilan keputusan pembelian seseorang konsumen, sehingga usaha ini mendukung tercapainya target penjualan dan laba yang diharapkan.
    Kotler ( 1993 ; 125 ) penerjemah Adi Zakaria, A. SifT berpendapat bahwa apabila produk fisik tidak dapat dengan mudah dibedakan kunci sukses persaingan terletak dalam menghadapi persaingan yaitu membedakan penawarannya dari apa yang ditawarkan oleh pesaing.
    Untuk melayani permintaan masyarakat akan kendaraan roda empat, maka di Jambi sudah ada beberapa perusahaan dealer kendaraan roda empat. Diantaranya perusahaan-perusahaan dealer kendaraan roda empat yang PT. Tunas yang memasarkan kendaraan roda empat merek Hyundai, PT. Sutan Kasim cabang Jambi yang memasarkan kendaraan merek Mitsubishi. CV. Jaya Inda Motor yang memasarkan kendaraan merek Suzuki dan Hino, PT. Samudra Bersaudara yang memasarkan kendaraan merk Suzuki dan Honda, Kerinci permata Motors yang memasarkan kendaraan merk Mitsubishi, PT. Sipin Jaya yang memasarkan kendaraan Toyota, PT. Agung Oto Mal yang memasarkan kendaraan merk Toyota serta perusahaan-perusahaan lainnya. Dimana dapat dilihat bahwa persaingan dalam memasarkan kendaraan roda empat Kota Jambi sangatlah kopetitif.
    PT. Sutan Kasim cabang Jambi contohnya, PT Sutan Kasim cabang Jambi yang mana perusahaan ini bergerak dibidang penjualan atau agen resmi dari kendaraan roda 4 merk Mitsubishi, yang mana memasarkan penjualan kendaraan roda 4 ( mobil ). Yang mana perusahaan ini mampu siap bersaing pada perusahaan-perusahaan besar yang telah dikemukakan diatas.
    Seperti perusahaan yang lainnya PT. Sutan Kasim Cabang Jambi tidak hanya memasarkan mobil namun juga menyertai usahanya dengan usaha jasa pendukung penjualan produk yaitu dengan menjual spare part serta jasa perawatan dan perbaikan.
    PT. Sutan Kasim Cabang Jambi dalam kegiatan pemasarannya juga memberikan dan menyediakan pelayanan purna jual yang ditujukan kepada kepuasan konsumen. Pelayanan purna jual tersebut mendukung produk dalam memenuhi kebutuhan konsumen. Selain itu pelaksanaan dari pelayanan purna jual dapat digunakan sebagai nilai tambah bagi produk perusahaan yang dipasarkan dalam persaingan. Faktor yang harus diperhatikan dalam mencapai peningkatan pelayanan salah satunya adalah kualitas pelayanan yang diberikan perusahaan kepada konsumen atau yang disebut faktor internal, disamping faktor eksternal seperti pendapatan penduduk, selera konsumen, peraturan pemerintah, keadaan perekonomian, teknologi dan kebudayaan.
    Sementara itu PT. Sutan Kasim Cabang Jambi selaku dealer mobil menyediakan tenaga ahli dalam merawat dan memperbaiki mobil. Pelayanan purna jual bagi PT. Sutan Kasim Cabang jambi memberikan kontribusi dalam hal pendapatan laba yang diharapkan. Hal ini merupakan salah satu bentuk tujuan PT. Sutan Kasim Cabang Jambi dalam rangka untuk memasarkan kendaraan roda empat (mobil).
    Adapun perkembangan volume penjualan kendaraan yang dipasarkan oleh PT. Sutan Kasim Cabang Jambi dapat dilihat pada tabel berikut ini:

    Tabel 1.1 Volume penjualan kendaraan roda empat (Mobil) pada PT. Sutan Kasim Cabang Jambi

    Tahun Total volume penjualan kendaraan roda empat (mobil ) per unit
    BARU BEKAS TOTAL PERKEMBANGAN (%)
    2002 9.500 1.464 10.964 –
    2003 7.500 1.000 8.500 7,14
    2004 7.150 1.150 8.300 (4,67)
    2005 1.500 500 2.000 (79,02)
    2006 2.500 700 3.200 (66,67)
    Sumber : PT Sutan Kasim Cabang Jambi 2006

    Dari tabel diatas dapat terlihat bahwa jumlah penjualan kendaraan roda empat ( mobil ) yang dilakukan oleh PT. Suka Fajar cabang Jambi mengalami peningkatan pada tahun 2002 sampai 2004. Pada tahun 2005 perusahaan menurun drastis dari penjualan tahun-tahun sebelumnya. Yang pada tahun ini PT. Sutan Kasim Cabang Jambi mengalami kerugian 79,02 % dari tahun sebelumnya. Ini dikarenakan pada tahun 2005 harga BBM yang relatif tinggi dan sulit diperdagangkan yang mana perusahaan lain juga mengalami hal yang sama. Tapi dari masalah BBM yang tinggi ini juga di karenakan akibat dari pelayanan purna jual yang diberikan kepada konsumen kurang memuaskan dan juga kurang baik yang mengakibatkan konsumen berpindah ke competitor atau perusahaan yang lainnya.
    Adapun perkembangan tingkat kepuasan konsumen terhadap pelayanan purna jual pada PT. Sutan Kasim cabang Jambi yang dapat dilihat pada tabel berikut :

    Table 1.2 Volume Tingkat Keluhan Konsumen Pada PT. Sutan Kasim Cabang Jambi

    Tahun Jumlah Visit Counsumer Perkembangan ( % )
    2002 1.464 –
    2003 1.527 0,43
    2004 1.557 0,19
    2005 2.114 35,77
    2006 2.642 24,97
    Sumber : PT. Sutan Kasim Cabang Jambi

    Dari table diatas dapat terlihat bahwa, jumlah keluhan di tahun 2005 sangat menaik sangat drastic yang mana terlihat di table diatas konsumen yang melakukan keluhan pada PT. Sutan Kasim Cabang, Jambi yaitu sebanyak 2.144 konsumen dengan persentase 35,77 yang mana pada tahun tersebut tingkat penjualan pun menjadi menurun yaitu berjumlah 1.500 unit kendaraan untuk penjualan baru sedangkan untuk kendaraan bekas berjumlah 500 unit kendaraan yang mana ini juga berdampak negative bagi perusaan itu sendiri, maka dari pada itu perusahaan ini hendaklah melakukan pelatihan bagi karyawannya, pelatihan tersebut adalah training untuk sebagai masukan bagaimana melakukan pelayanan purna jual yang baik bagi konsumen.
    Dari uraian diatas maka penulis tertarik untuk melakukan penelitian yang selanjutnya diwujudkan kedalam bentuk penulisan skripsi dengan judul ” Analisis Kepuasan Konsumen Terhadap Pelayanan Purna Jual Pada PT. Sutan Kasim Cabang Jambi ” .

    1.2. Identifikasi Masalah
    PT. Sutan Kasim Cabang Jambi bergerak dibidang jasa pelayanan purna jual kendaran dan servise untuk kendaraan roda empat pada umumnya, tetapi pada saat ini sudah banyak jenis dari perusahaan yang sama dan sejenis yang bergerak dibidang yang sama. Karena itu untuk memenangkan persaingan diperlukan tindakan yang cermat dan kreatif dari perusahaan, salah satu cara untuk memenangkan persaingan itu adalah dengan mengevaluasi kepuasan konsumen yang melakukan pembelian dan penggunaan jasa pelayanan purna jual pada PT. Sutan Kasim Cabang Jambi.
    Kepuasan konsumen sangat berdampak positif terhadap penjualan suatu jasa yang dihasilkan, jika jasa yang dihasilkan dapat memberikan kepuasan tersendiri kepada konsumennya maka jasa tersebut sudah dapat menjadi jasa unggulan yang dapat dipakai oleh konsumen secara berkelanjutan.
    Sehubungan dengan permasalahan tersebut, maka penulis mengidentifikasikan permasalahan yang ada sebagai berikut “ Bagaimanakah tingkat kepuasan konsumen terhadap pelayanan purna jual pada PT. Sutan Kasim Cabang Jambi ?”.

    1.3. Perumusan Masalah
    Dalam menghadapi persaingan PT. Sutan Kasim Cabang Jambi. Aktivitas penjualan kendaraan juga dituntut mengembangkan usahanya dalam bentuk aktivitas pelayanan purna jual demi memberikan kepuasan pada konsumen.
    Secara teori pelayanan purna jual adalah pelayanan yang diberikan perusahaan kepada konsumen setelah pembelian yang meliputi penyediaan suku cadang produk, penyediaan tenaga mekanik atau ahli, pemberian jaminan melayani konsumen dalam hal penawaran dan perbaikan produk.
    Penurunan perusahaan dari bidang ini dapat berakibat pada semakin rendahnya konstribusi laba yang diterima oleh perusahaan, yang aman akan berpengaruh terhadap kelangsungan hidup perusahaan itu sendiri.
    Adanya kenaikan dan penurunan penerimaan dari aktivitas pelayanan service kendaraan purna jual bidang di pengaruhi dari pelaksanaan kualitas pelayanan service kendaraan purna jual yang di berikan dan disediakan oleh PT. Sutan Kasim Cabang Jambi ditujukan kepada kepuasan konsumen guna mencapai target penjualan dan laba yang diharapkan.
    Bertitik tolak dari uraian diatas maka dirasa perlu dilakukan penelitian terhadap pelaksanaan pelayanan purna jual yang dilaksanakan pada PT. Sultan kasim Cabang Jambi. Adapun yang menjadi pokok permasalahan dari penelitian ini adalah : “ Bagaimana tingkat kepuasan konsumen terhadap pelayanan purna jual pada PT. Sutan Kasim Cabang Jambi “.

    1.4. Tujuan Dan Manfaat Penelitian
    1.4.1. Tujuan Penelitan
    a. Untuk mengetahui tingkat kepuasan konsumen terhadap pelayanan purna jual pada PT. Sutan Kasim Cabang Jambi
    b. Untuk menganalisa tingkat kepuasan konsumen terhadap pelayanan purna jual pada PT. Sutan Kasim Cabang Jambi.

    1.4.2. Manfaat Penelitian
    Hasil penelitian itu dapat memberikan konstribusi yang dapat digunakan sebagai bahan dan informasi untuk merumuskan kebijaksanaan pelaksanaan pelayanan service kendaraan purna jual PT. Sutan Kasim Cabang Jambi dimasa yang akan datang.
    Bagi penulis sebagai tambahan wawasan dan pengetahuan tentang masalah yang diteliti sehingga dapat memperoleh kesesuaian fakta dilapangan dengan teori yang ada. Hasil penelitian ini dapat memberikan konstribusi bagi peneliti lainnya yang terkait dengan pelaksanaan purna jual dengan model pendekatan lain.

    1.5. Batasan Masalah
    Penulis disini tertarik meneliti volume tingkat penjualan kendaraan roda empat ( mobil ) baru ketimbang kendaraan roda empat ( mobil ) bekas. Dikarenakan bahwa kendaraan baru lebih dominant yang mana terdapat free service ( servis gratis ), menyediakan suku cadang asli, pemberian potongan dan garansi, yang mana kesemuannya tersebut yang dapat menimbulkan kepuasan akan pelayanan purna jual pada PT. Sutan Kasim cabang Jambi.

    BAB II
    TINJAUAN PUSTAKA DAN METODOLOGI PENELITIAN

    2.1. Tinjauan Pustaka
    2.1.1. Landasan Teori
    Pada penelitian ini, peneliti menggunakan berbagai istilah-istilah dan batasan-batasan yang dapat dijelaskan sebagai berikut:
    a. Manajemen
    Menurut T. Hun Handoko (1993,hal 7) Manajemen adalah: Suatu proses perencanaan, pengorganisasian, pengarahan dan pengawasan usaha-usaha para anggota organisasi dan sumber daya organisasi yang telah ditetapkan.
    b. Manajemen Pemasaran
    Menurut Kotler (1997,hal 13) Manajemen Pemasaran adalah: Proses perencanaan dan pelaksanaan pemikiran, penetapan harga, promosi dan distribusi gagasan, barang dan jasa untuk menciptakan pertukaran yang memuaskan tujuan individu dan organisasi.
    c. Analisis
    Menurut Kamaruddin (1993,hal 45) Analisis adalah. kegiatan berpikir, mempelajari bagian-bagian komponen atau elemen dari suatu keseluruhan untuk masing-masing bagian, komponen atau elemen dari suatu keseluruhan untuk masing-masing bagian, komponen atau elemen itu sendiri hubungan lain dan fungsi mereka dalam keseluruhan yang terpadu.

    d. Prilaku Konsumen
    Menurut Enggel,dkk (1994,hal 4) Prilaku Konsumen adalah tindakan yang langsung telibat dalam mendapatkan, mengkonsumsi dan menghabiskan produk dan jasa termasuk proses-proses keputusan yang mendahului dan menyusuli tindakan ini.
    e. Kepuasan
    Menurut Kotter (l997,hal 36) Kepuasan adalah perasaan senang atau kecewa seseorang yang berasal dari perbandingan antara persepsinya terhadap kinerja atau hasil suatu jasa dan harapan-harapannya. Jadi kepuasan adalah perasaan yang dialami seseorang setelah menggunakan suatu produk dengan membandingkan kinerja dan harapannya.
    f. Konsumen
    Menurut Ujang Sumarwan (2002,hal 24) Istilah konsumen sering diartikan sebagai dua jenis konsumen yaitu :
    Konsumen individu ialah konsumen yang mebeli batang atau jasa untuk digunakan sendiri. Sedangakan konsumen organisasi adalah kosumen yang membeli produk atau jasa lainnya untuk menjalankan seluruh kegiatan organisasinya.
    g. Kepuasan Konsumen
    Menurut Kotler (1997, hal 6) kepuasan konsumen adalah tingkat perasaan seseorang setelah membandingkan kinerja atau hasil yang ia rasakan dibandingkan dengan harapan.
    h. Jasa
    Menurut Kotler (1997, hal 48) jasa adalah setiap kegiatan atau manfaat yang ditawarkan oleh suatu pihak kepada pihak lain dan pada dasarnya tidak berwujud, serta tidak menghasilkan kepemilikan sesuatu.
    i. Pelayanan
    Menurut Nitisesmito (1991, hal 126) dikatakan bahwa pelayanan adalah merupakan salah satu kegiatan dalam bidang marketing yang bertujuan untuk meningkatkan omset penjualan dengan cara mempengaruhi konsumen baik secara langsung maupun secara tidak langsung.
    j. Pelayanan Purna Jual
    Menurut Siswanto RS (1991,hal 36) adalah pelayanan yang diberikan perusahaan kepada konsumen setelah pembelian meliputi penyediaan suku cadang produk, penyediaan tenaga ahli, memberikan jaminan, melayani konsumen dalam hal perbaikan dan perawatan produk dan lain-lainnya.
    k. Kualitas Pelayanan
    Menurut Fitzsimmonz (1994,hal 67) adalah sebagai kualitas yang dibuat selama proses pelayanan dengan menempatkan pelanggan dalam pelanggan pribadi, sedangkan kualitas pelayanan yang dirasakan dibandingkan dengan yang diharapkan oleh pelayanan yang berkaualitas.
    l. PT (Perseroan Terbatas)
    Menurut An Sudarman (1992,hal 87) adalah suatu persekutuan yang menjalankan perusahaan dalam bentuk badan hokum dimana modalnya terdiri dari atas sero atau saham sehingga persekutuan tersebut disebut perseroaan.

    2.2 Metode Penelitian
    2.2.1 Jenis dan Sumber Data
    Jenis data yang digunakan dalam penelitian ini adalah :
    1. Data primer data yang diperoleh secara langsung berdasarkan kuisioner yang telah disusun meliputi data tentang kepuasan konsumen terhadap pelayanan purna jual PT. Sutan Kasim Cabang Jambi.
    2. Data Skunder, data yang diperoleh melalui literature-literatur ilmiah, sejarah perusahaan dan struktur organisasi perusahaan dan data penjualan. Sumber data yang diperlukan pada penelitian di PT. Sutan Kasim
     PT. Sutan Kasim Cabang Jambi
     Dispenda, Deperindag Kota Jambi
     Instalasi terkait lainnya.
     Samsat provinsi jambi

    2.2.2 Metode Pengumpulan Data.
    1. Penelitian Kepustakaan (Library Research)
    Penelitian kepustakaan (Liberaly Research) yaitu membandingkan data yang dilakukan atas studi literatur-literatur, laporan-laporan dan tulisa lainnya yang berkaitan dengan masalah yang diteliti.

    2. Penelitian Lapangan (Field Research)
    Data yang dikumpulkan dalam pernelitian ini dengan menggunakan metode sebagai berikut:
    Untuk mendapatkan data primer ini dilakukan penelitian langsung ke kantor PT. Sutan Kasim Cabang Jambi yang menjadi objek penelitian dengan melakukan, observasi dengan meninjau secara langsung terhadap kegiatan yang dijalankan perusahaan tersebut dan mengamati secara seksama semua variabel yang diperlukan sesuai dengan tujuan penelitian, wawancara kepada pihak yang berwewenang dalam PT. Sutan Kasim Cabang Jambi.

    2.2.3 Tehnik Pengambilan Sampel
    Penelitian ini bertujuan untuk mendapatkan data dan informasi yang benar jelas atau dapat di percaya reliabel tentang pelaksanaan pelayanan purna jual pada PT. Sutan Kasim Cabang Jambi. Budiyono (1990; 130) mendefinisikan secara universal adalah keseluruhan dari objek yang diteliti. Besarnya sample yang akan dijadikan responden dalam penelitian ini dihitung dengan menggunakan rumus slovin ( Dalam Husain Umar, 2003 ; 108 ). Populasi dalam penelitiam ini adalah jumlah konsumen pada PT. Sutan Kasim cabang Jambi yang diberikan pelayanan purna jual yang mana dalam hal ini konsumen yang memakai jasa pelayanan purna jual type kendaraan baru dikarenakan, bahwa kendaraan baru ini lebih banyak nilai lebihnya dari kendaraan type jenis bekas. Yang mana sample yang dipakai adalah populasi yang memakai jasa purna jual type kendaraan baru pada tahun 2006 sebanyak 2.500 konsumen.
    Responden diminta untuk meminta pertimbangan jawaban atas beberapa pertanyaan yang berhubungan dengan tingkat kepentingan konsumen dan penilaian pelayanan service kendaraan yang telah diterima oleh konsumen pada PT. Sutan Kasim Cabang Jambi.
    Maka sample yang dijadikan responden dan dipandang dapat mewakili populasi yang telah ada sebanyak 96 konsumen yang melakukan pelayanan purna jual pada PT. Sutan Kasim cabang Jambi, pada saat penelitian ini berlangsung.

    2.2.4 Metode Analisis
    Untuk mengkaji topik ini metode analisis yang digunakan adalah :
    a. Metode Deskriptif yaitu menganalisis dan mengkaji antara kepuasan konsumen terhadap pelayanan purna jual pada PT. Sutan Kasim cabang Jambi yang relevan dengan penelitian ini sehingga mampu menjelaskan permasalahannya.
    b. Metode Kuantitatif yaitu semua cara yang dapat dipakai sebagai alat dalam menarik kesimpulan yang berlaku umum dari data yang tersusun sebelumnya.

    2.2.5 Alat Analisis
    Karena metode pengumpulan data untuk mengukur kepuasan pelayanan purna jual pada PT. Sutan Kasim cabang Jambi digunakan Derived Satisfaction dimana konsumen diberi pertanyaan mengenai seberapa besar mereka mengharapkan suatu jasa dan seberapa besar yang mereka rasakan, maka untuk menghitung skor yang diperoleh dari hasil pengisian quisioner digunakan alat analisis Sakala Likert, dimana bobot yang diberikan sebagai berikut.
    Nilai 1 = Sangat Tidak Puas
    Nilai 2 = Tidak Puas
    Nilai 3 = Cukup Puas
    Nilai 4 = Puas
    Nilai 5 = Sangat Puas
    Selain menggunakan metode analisis diskriptif juga menggunakan metode rentang skala sebagai alat perbandingan tersebut.
    Untuk mengukur tingkat kepuasan konsumen secara keseluruhan maka digunakan rumus Skor Kepuasan = (kinerja – harapan)
    Dari rumus tersebut, apabila kinerja lebih besar dari harapan maka jasa dikatakan sangat memuaskan, dan jika kinerja sama dengan harapan maka pelayanan dikatakan memuaskan, tetapi jika kinerja lebih kecil dari harapan maka jasa dikatakan tidak memuaskan.

    DAFTAR PUSTAKA
    Assuri Sofyan, 1996, Manajemen Pemasaran, Ghalia Indonesia Jakarta
    Kotler, Philip, 1995, Manajemen Pemasaran Analisis Perencanaan Implementasi dan Pengendalian,LP FE – UI, Jakarta
    Masri Singarimbun, 1999, Metodologi Penelitan dan Survey, Angkara Jakarta
    Moekidjat, 1994, Manajemen, Pemasaran, Jilid I, Erlangga Jakarta
    Moekidjat, 1994, Manajemen, Pemasara, Jilid II, Erlangga Jakarta
    T, Hani Handoko, 1996, Pengatur Manajemen, Erlangga Jakarta
    Tjiptono Fandy, 1997, Manajemen Sumber Daya Manusia
    Umar, Husein, 2003, Metode Penulisan Skripsi dan Tesis untuk Mahasiswa, Liberti Jakarta
    Walker, 1989, manajemen pemasaran II, Jakarta

    Rumusan masalah di atas belum tuntas, populasinya juga belum. Harap diperbaiki.

    Komentar oleh LIDYA ANASTASIA | Januari 20, 2012 | Balas

  141. PROPOSAL TENTATIF.
    Nama : Rachmat Putra Chayadri
    Nim : ERC1B009069
    Kelas Ekstensi Sore

    JUDUL : PENGARUH CITRA MINIMARKET TERHADAP LOYALITAS PELANGGAN
    PADA MINIMARKET TUNAS HARAPAN JAYA.

    BAB I
    PENDAHULUAN
    A. Latar Belakang Masalah
    Ada banyak alasan mengapa minimarket begitu memukau dan menyedot konsumen untuk berdatangan, yaitu selain tempatnya yang nyaman (sejuk, bersih, dan luas), lokasi yang stategis (berada pada pusat kota),harga yang diberikan pun sangat bersaing dan tidak kalah pentingnya yaitu pilihan produknya yang juga begitu banyak.Di dalam minimarket kita bisa mendapatkan mulai dari keperluan dapur hingga furniture , kebutuhan rumah tangga hingga perlengkapan kantor, dan produk fashion ataupun barang-barang elektronik.Waktu operasinya juga panjang hingga pukul 21.00 bahkan sesekali,menjelang Lebaran dan Tahun Baru, minimarket buka hingga 24 jam.Beberapa minimarket juga membuka layanan antar sehingga pelanggan benar-benar telah menjadi raja.
    Minirmarket yang baru muncul sekitar beberapa tahun yang lalu, sudah terasa sangat akrab di dalam benak masyarakat Indonesia. Bahkan mulai merebut hati pelanggan melebihi toko -toko grosir tradisional.Telah diketahui bahwa pasar Indonesia merupakan pasar yang sangat potensial untuk memasarkan produk dan jasa.Konsumen Indonesia cukup cepat menerima masuknya suatu hal baru, seperti semakin maraknya mal- mal dan pasar swalayan di beberapa kota di Indonesia menjadi suatu hal yang sangat menarik untuk dimasuki oleh para pemasar.Seiring dengan semakin banyaknya gerai minimarket di Indonesia,maka semakin kecil pangsa pasar yang dimiliki oleh masing- masing minirmarket. Kesuksesan minimarket adalah minimarket yang mampu memenangkan pilihan pelanggan dan mempertahankannya. Jambi merupakan tempat yang paling cocok untuk pengembangan bisnis ritel,karena sebagian penduduknya adalah pendatang yang mempunyai kesibukan tersendiri,misalnya adalah sekolah,kuliah,dan kerja.Dengan adanya minimarket seperti Tunas Harapan Jaya maka akan sangat membantu mereka para pendatang,dan sebaliknya bagi Tunas Harapan Jaya akan cepat berkembang karena pertumbuhan penduduk Jambi, khususnya di daerah Kebun Kopy sangat cepat dan juga modern sehingga kemungkinan masyarakat untuk berbelanja di minimarket sangat besar.
    Dalam melakukan pemilihan tempat berbelanja,konsumen akan melihat beberapa dimensi atau faktor-faktor tertentu yang menunjukkan bahwa tempat belanja tersebut dapat memenuhi kebutuhannya baik secara material maupun psikologis yang nantinya akan membawa pada tingkat loyalitas pelanggan terhadap minimarket.Minimarket yang merupakan tempat berbelanja yang sangat diminati oleh konsumen di era modern ini,harus memiliki karakteristik tertentu yang membedakan dengan minimarket atau supermarket lain sehingga konsumen tertarik untuk mengunjunginya dan bertransaksi didalamnya.Demi menarik minat konsumen agar berkunjung dengan sendirinya ke dalam minimarket,maka sebuah minimarket harus membentuk suatu citra yang baik mulai dari segi tampilan fisik, pelayanan hingga suatu citra khas yang telah menjadi konsep minimarket tersebut.
    Pentingnya sebuah citra minimarket akan membawa perusahaan tersebut kepada kesuksesan dan kelangsungan hidupnya.Citra minimarket ini dapat dibentuk melalui berbagai dimensi yang kemungkinan besar akan selalu dilihat oleh para konsumen sebelum mereka berkunjung ke dalam sebuah minimarket.Dimana dengan dibentuknya dimensi-dimensi tersebut diharapkan para konsumen akan tertarik berkunjung ke dalam minimarket dan menjadi loyal terhadap minimarket.Oleh karena itu,dalam kesempatannya penulis melakukan sebuah penelitian dengan tema “Pengaruh Citra Minimarket Terhadap Loyalitas Pelanggan pada Tunas Harapan Jaya”.

    B. Perumusan Masalah
    Dalam memutuskan tempat belanja yang tepat,pelanggan akan melihat bagaimana citra sebuah minirmarket ataupun tempat belanja lainnya sebelum masuk ke dalamnya.Hal ini dilakukan karena pada umumnya pelanggan akan sangat selektif dalam memilih tempat belanjanya demi tujuan menciptakan loyalitas terhadap minimarket. Dari uraian di atas dan berdasarkan pada latar belakang masalah, maka perumusan masalah pada penelitian ini adalah sebagai berikut:
    1.Bagaimana pengaruh dimensi citra minimarket kelengkapan produk terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya? 2.Bagaimana pengaruh dimensi citra minimarket pelayanan terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?
    3.Bagaimana pengaruh dimensi citra minimarket kelengkapan fasilitas terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?
    4.Bagaimana pengaruh dimensi citra minimarket lingkungan fisik terhadap loyalitas pelanggan pada Minimarket Tunas HarapanJaya?
    5.Manakah variabel dimensi citra minimarket yang paling dominan berpengaruh terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?

    C.Tujuan Penelitian
    Adapun tujuan dari penelitian ini adalah sebagai berikut:
    1.Untuk mengidentifikasi pengaruh dimensi citra minimarket kelengkapan produk terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
    2.Untuk mengidentifikasi pengaruh dimensi citra minimarket pelayanan terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
    3.Untuk mengidentifikasi pengaruh dimensi citra minimarket kelengkapan fasilitas terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
    4.Untuk mengidentifikasi pengaruh dimensi citra minimarket lingkungan fisik terhadap loya litas pelanggan pada Minimarket Tunas Harapan Jaya.
    5.Untuk mengidentifikasi manakah variabel dimensi citra minimarket yang paling dominan berpengaruh terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.

    D.Manfaat Penelitian
    Ada beberapa manfaat dari penelitian ini,yaitu:
    1.Peneliti:dapat memperkaya pengetahuan tentang perilaku konsumen,dan mengaplikasikan konsep-konsep dan teori-teori mengenai citra minimarket dan loyalitas pelanggan khususnya pada “Minimarket Tunas Harapan Jaya”.
    2.Perusahaan:hasil penelitian ini dapat digunakan sebagai acuan pihak manajemen Minimarket Tunas Harapan Jaya untuk memenuhi kepentingan perusahaan terutama dalam menciptakan loyalitas pelanggan melalui citra minimarket.
    3.Komunitas akademik:memberikan literatur mengenai citra minimarket dan loyalitas pelanggan,khususnya pada industri ritel (eceran).

    BAB II
    OBJEK DAN METODE PENELITIAN
    A. Objek Penelitian
    Objek penelitian merupakan sesuatu yang menjadi perhatian dalam suatu
    penelitian, objek penelitian ini menjadi sasaran dalam penelitian untuk mendapatkan
    jawaban ataupun solusi dari permasalahan yang terjadi.
    pengertian objek penelitian adalah sebagai berikut:
    “Objek penelitian menjelaskan tentang apa atau siapa yang menjadi objek penelitian.
    Juga dimana dan kapan penelitian di lakukan. Bisa juga ditambahkan hal-hal lain jika
    di anggap perlu”.
    Dalam penyusunan proposal usulan penelitian ini objek yang menjadi sasaran
    pengamatan penyusunan adalah Kualitas Layanan sebagai variable bebas (variable
    x1) dan Kepuasan sebagai variable bebas (variable x2) sementara objek penelitian
    yang merupakan variabel terikat (Variabel Y) adalah Loyalitas pelanggan, sedangkan
    yang menjadi responden adalah para konsumen minimarket Tunas Harapan Jaya daerah kebun kopi jambi. Penelitian ini di laksanakan di Minimarket Tunas Harapan Jaya.

    B. Metode Penelitian
    Metode penelitian merupakan cara penelitian yang digunakan untuk
    mendapatkan data untuk mencapai tujuan tertentu
    Metode yang digunakan dalam penelitian ini adalah deskriftif dan verifikatif. :
    “metode deskriftif adalah metode yang digunakan untuk menggambarkan atau
    menganalisis suatu hasil penelitian tetapi tidak digunakan untuk kesimpulan yang
    lebih luas”.
    Sedangkan metode verifikatif :
    “metode verifikatif yaitu memeriksa benar tidaknya apa bila di jelaskan untuk
    menguji suatu cara dengan atau tanpa perbaikan yang telah di laksanakan di tempat
    lain dengan masalah yang serupa dengan kehidupan”.

    C. Disain Penelitian
    Dalam penulisan ini, desain penulisan yang penulis teliti adalah mengenai
    “Pengaruh citra minimarket terhadap loyalitas pelanggan pada minimarket tunas harapan jaya. Setelah data di peroleh maka data itu akan diolah dan dianalisis.
    Penelitian deskriptif adalah :
    “Penelitian yang dilaksanakan terhadap variabel mandiri, yaitu membuat
    bandingan atau menghubungkan variabel lain. Dalam pemahaman lain, penelitian
    deskriptif merupakan bentuk penelitian yang menggabungkan kejadian sesungguhnya
    di lapangan tentang objek yang akan di teliti sehingga dapat di capai sesuatu
    kesimpulan sementara”.
    Adapun penelitian deskriptif ini dilakukan untuk mengetahu gambaran
    sesungguhnya tentang peranan Kualitas Layanan dan kepuasan dalam meningkatkan
    Loyalitas pelanggan pada minimarket Tunas Harapan jaya di kebun kopi jambi.
    Sementara itu penelitian verifikatif adalah merupakan pembuktian untuk
    menguji hipotesis hasil penelitian deskriptif melalui suatu penghitungan statistik
    sehingga di dapat hasil pembuiktian yang membuktikan bahwa hipotesis dapat ditolak
    atau diterima. Adapun objek yang di uji dalam penelitian ini adalah pengaruh
    Kualitas layanan dan kepuasaan terhadap loyalitas pelanggan.
    Langkah-langkah desain penelitian adalah sebagai berikut:
    1. Menetapkan permasalahan sebagai indikasi dari fenomena penelitian, selanjutnya
    menetapkan judul penelitian.
    2. Mengidentifikasi permasalahan yang terjadi.
    3. Menetapkan rumusan masalah.
    4. Menetapkan tujuan penelitian.
    5. Menetapkan hipotesis penelitian berdasarkan fenomena dan dukungan teori.
    6. Menetapkan konsep variabel sekaligus pengukuran variabel penelitian yang
    digunakan.
    7. Menetapkan sumber data, teknik penentuan sampel, dan teknik pengumpulan data.
    8. Melakukan analisis data.
    9. Melakukan pelaporan hasil penelitian.

    D.Operasional Variabel
    Operasional variable adalah langkah yang harus dilakukan sebelum
    mengadakan penilaian dan penelitian, hal ini dapat mempermudah dalam melakukan
    penelitian. Operasional variable ini diperlukan untuk menentukan jenis, indikator,
    serta skala dari variable-variabel yang terkait dalam penelitian, sehingga pengujian
    hipotesis dapat dilakukan sesuai dengan judul penelitian mengenai pengaruh citra minimarket terhadap loyalitas pelanggan. Maka variable-variabel yang
    terkait dalam penelitian ini adalah :
    a.Variabel Bebas / Independent (Variabel X) yaitu :
    X1 = Kualitas Layanan
    X2 = Kepuasan
    Devinisi tentang variabel bebas sebagai berikut :
    “Variabel bebas adalah variabel yang mempengaruhi atau yang menjadi sebab
    perubahannya atau timbulnya variabel dependent (terikat)”.
    b.Variabel Terikat / Dependent (Variabel Y) yaitu Loyalitas Pelanggan.
    devinisi variabel terikat sebagai berikut :
    “Variabel terikat merupakan variabel yang dipengaruhi atau yang menjadi akibat,
    karena adanya variabel bebas”.

    E.Sumber dan Teknik penentuan data
    Sumber Data
    Jenis data yang digunakan peneliti dalam penelitian mengenai “ pengaruh citra minimarket terhadap loyalitas pelanggan pada minimarket tunas harapan jaya kebun kopi kota jambi.
    1. Data Primer
    devinisi tentang sumber primer sebagai berikut :
    “Sumber primer adalah sumber data yang langsung memberikan data kepada
    pengumpul data”.
    Pengumpulan data primer dalam penelitian ini melalui cara menyebarkan kuesioner
    dan melakukan wawancara secara langsung dengan pihak-pihak yang berhubungan
    dengan penelitian yang dilakukan, dalam hal ini adalah konsumen yang berbelanja
    pada minimarket.

    2. Data Sekunder
    devinisi tentang sumber sekunder sebagai berikut
    “Sumber sekunder adalah sumber data yang diperoleh dengan cara membaca,
    mempelajari dan memahami melalui media lain yang bersumber dari literatur, buku-
    buku, serta dokumen perusahaan”.
    Metode yang digunakan adalah metode deskriptif analisis karena penelitian ini
    berkaitan dengan pendapat atau opini individu akan kinerja manajemen perusahaan.
    Objek penelitian dalam studi kasus ini dititikberatkan pada masalah pemilihan
    Kualitas layanan dan kepuasaan dimana pengambilan data dilakukan secara observasi
    langsung pada divisi pemasaran serta penyebaran kuesioner pada masyarakat secara
    langsung pandangan responden, pengambilan data ini dirasakan cukup mewakili
    untuk kebutuhan pengolahan data yang akan dilakukan peneliti.

    F.Teknik Penentuan Data
    1.Populasi
    bahwa pengerian populasi adalah sebagai berikut :
    ”Populasi merupakan wilayah generalisasi yang terdiri atas objek atau subjek yang
    mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk
    dipelajari dan kemudian ditarik kesimpulannya”.
    Populasi dari penelitian ini adalah jumlah pembeli selama tiga bulan terakhir yaitu
    bulan oktober-desember 2011 berjumlah kurang lebih 156 orang. Pemilihan jumlah
    populasi ini dirasakan cukup mewakili untuk memberikan data yang diperlukan
    dalam penelitian.
    2.Sampel
    pengertian sampel, yaitu sebagai berikut :
    ”Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh populasi tersebut”.
    Kesimpulan dari pengertian tersebut adalah sebagian jumlah dan karakteristik yang
    dimiliki oleh sampel tersebut. Apabila populasinya besar dan memungkinkan peneliti
    tidak dapat mempelajari semua yang ada pada populasi, misalnya karena keterbatasan
    waktu dan dana, maka peneliti dapat menggunakan sampel yang diambil dari
    populasi. Karena sempel tersebut dapat mewakili data yang ada dan membantu
    penulis dalam melakukan penghitungan.
    Teknik sampel yang digunakan adalah random sampling anggota populasi yang
    dibutuhkan secara acak tanpa menggunakan starta yang ada dalam anggota populasi
    dengan kata lain populasi dianggap homogen, dengan jumlah kelonggaran
    ketidaktelitian karena kesalahan pengambilan sampel sebesar 10%. Untuk mengambil
    jumlah sampel, penulis menggunakan rumus Slovin yaitu sebagai berikut:
    Keterangan:
    n : Ukuran sampel
    N: Ukuran populasi
    N
    n = ––––––
    1 + Ne²
    e : Tingkat kesalahan dalam meraih anggota sampel yang ditolerir
    (tingkat kesalahan yang diambil dalam sampling ini sebesar 10%).
    Dengan menggunakan rumus tersebut, maka ukuran sample dapat di hitung
    sebagai berikut :
    Dengan menggunakan metode deskriptif, maka minimal tingkat kesalahan dalam
    penentuan anggota sampel yang harus diambil adalah 10% dari jumlah populasi yang
    diketahui. Jadi dapat diketahui dari perhitungan untuk ukuran sample dengan tingkat
    kesalahan sebesar 10% adalah sebanyak 99.36 atau dibulatkan menjadi 100
    responden. Tapi untuk mengurangi resiko kerusakan atau hilangnya angket
    maka pembuatan angket pun digenapkan menjadi 100 buah.

    156
    n = ––––––––––
    1+156 (0,1)²
    156
    n = –––––––––––
    1+156 (0,01))

    n = 99.36
    156
    n = ––––
    1,57

    Teknik Pengumpulan Data
    Adapun teknik pengumpulan data yang digunakan penulis untuk memperoleh
    data serta informasi yang diperlukan adalah sebagai berikut :
    1. Pengamatan (Observation)
    Merupakan teknik yang menuntut adanya pengamatan dari peneliti baik secara
    langsung ataupun tidak langsung terhadap objek penelitiannya. Hasil dari observasi
    dapat dijadikan data pendukung dalam menganalisis dan mengambil kesimpulan.
    Observasi dalam penelitian ini akan dilaksanakan di minimarket serta para konsumen
    yang berbelanja di minimarket

    2. Kuesioner
    Merupakan teknik pengumpulan data yang di lakuakan dengan cara memberi
    seperangkat pertanyaan atau pernyataan tertulis berbentuk formulir kepada seseorang
    atau sekumpulan orang (responden) untuk mendapatkan jawaban, tanggapan dan
    informasi yang diperlukan oleh peneliti. Peneliti memberikan kuesioner yang berisi
    beberapa pertanyaan yang terkait dengan kualitas layanan dan kepuasaan terhadap
    loyalitas pelanggan pada minimarket koperasi Pegawai Pemerintah Kota Bandung.
    Kuesioner yang digunakan adalah kuesioner tertutup yang telah di beri skor, dimana
    data tersebut nantinya akan dihitung secara statistik.

    3. Wawancara (Interview)
    Merupakan teknik pengumpulan data dengan cara melakukan tanya jawab langsung
    secara lisan dengan pihak-pihak yang dianggap dapat memberikan informasi yang
    sesuai dengan kebutuhan khususnya yang menyangkut pengaruh Kualitas layanan
    dan kepuasan terhadap loyalitas pelanggan. Dalam teknik wawancara ini, penulis
    mengadakan Tanya jawab kepada sumber yang dapat memberikan data atau
    informasi. Informasi itu berupa apa saja yang berkaitan dengan Kualitas layanan dan
    kepuasan terhadap loyalitas pelanggan. Adapun sumber informasi dalam penelitian
    ini adalah pihak marketing perusahaan.

    4. Dokumentasi
    Merupakan proses pengumpulan data dengan mempelajari, menganalisa, dan
    menelaah dokumen-dokumen yang terdapat pada perusahaan berkaitan dengan
    pengaruh Kualitas layanan dan kepuasan terhadap loyalitas pelanggan.

    DAFTAR PUSTAKA
    Alma, B. 2005. Manajemen Pemasaran dan Pemasaran Jasa. Edisi Revisi. CV. Alfabeta. Bandung.
    Anaz, S. 2007. Pengaruh Kualitas Jasa Pelayanan Terhadap Kepuasan Konsumen Pada Wisata Bahari Lamongan. Skripsi UNNES.
    Kotler, Philip. 2005. Manajemen Jasa. PT. Indeks. Jakarta.
    Pramesti, G. 2008. Solusi Express SPSS 15.0. PT Elex Media Komputindo Kelompok Gramedia. Jakarta.
    Priyatno, D. 2008. Mandiri Belajar SPSS. PT Buku Kita. Yogyakarta.
    Rangkuti, F. 2006. Measuring Customer Satisfaction. PT. Gramedia Pustaka Utama. Jakarta.
    Riduwan, D. 2007. Skala Pengukuran Variabel-Variabel Penelitian. Alfabeta. Bandung.
    Supranto, J. 2001. Pengukuran Tingkat Kepuasan Pelanggan. Edisi Baru. PT. Rineka Cipta. Jakarta.
    Tjiptono, F., dan Chandra, G. 2005. Service Quality and Satisfaction. Andi Yogyakarta
    Usman, H., dan Akbar, P. 2006. Pengantar Statistika. Edisi Kedua. Bumi Aksara Yogyakarta.
    Usman, H. 2008. Analisis Perbedaan Kepuasan Nasabah Sebelum dan Sesudah Menggunakan Layanan Jasa Mobile Banking di Yogyakarta. Skripsi UNAS.
    Usman, H. 2008. Analisis Pengaruh Kualitas Layanan Terhadap Kepuasan Konsumen Pemakai Hotel Jayakarta Yogyakarta. Skripsi UNAS.

    RAhcmat yg dilaporkan hendaknya sesuai dg apa yg diminta saat kuliah. Populasi anda siapa, dan sampel bagaimana akan dipilih itu yg lebih penting.

    Komentar oleh Rachmat Putra | Januari 23, 2012 | Balas

    • Perbaikan Untuk Populasi dan sampelnya pak jo…

      Nama : Rachmat Putra Chayadri
      Nim : ERC1B009069
      Kelas Ekstensi Sore
      JUDUL : PENGARUH CITRA MINIMARKET TERHADAP LOYALITAS PELANGGAN
      PADA MINIMARKET TUNAS HARAPAN JAYA.
      BAB I
      PENDAHULUAN
      A. Latar Belakang Masalah
      Ada banyak alasan mengapa minimarket begitu memukau dan menyedot konsumen untuk berdatangan, yaitu selain tempatnya yang nyaman (sejuk, bersih, dan luas), lokasi yang stategis (berada pada pusat kota),harga yang diberikan pun sangat bersaing dan tidak kalah pentingnya yaitu pilihan produknya yang juga begitu banyak.Di dalam minimarket kita bisa mendapatkan mulai dari keperluan dapur hingga furniture , kebutuhan rumah tangga hingga perlengkapan kantor, dan produk fashion ataupun barang-barang elektronik.Waktu operasinya juga panjang hingga pukul 21.00 bahkan sesekali,menjelang Lebaran dan Tahun Baru, minimarket buka hingga 24 jam.Beberapa minimarket juga membuka layanan antar sehingga pelanggan benar-benar telah menjadi raja.
      Minirmarket yang baru muncul sekitar beberapa tahun yang lalu, sudah terasa sangat akrab di dalam benak masyarakat Indonesia. Bahkan mulai merebut hati pelanggan melebihi toko -toko grosir tradisional.Telah diketahui bahwa pasar Indonesia merupakan pasar yang sangat potensial untuk memasarkan produk dan jasa.Konsumen Indonesia cukup cepat menerima masuknya suatu hal baru, seperti semakin maraknya mal- mal dan pasar swalayan di beberapa kota di Indonesia menjadi suatu hal yang sangat menarik untuk dimasuki oleh para pemasar.Seiring dengan semakin banyaknya gerai minimarket di Indonesia,maka semakin kecil pangsa pasar yang dimiliki oleh masing- masing minirmarket. Kesuksesan minimarket adalah minimarket yang mampu memenangkan pilihan pelanggan dan mempertahankannya. Jambi merupakan tempat yang paling cocok untuk pengembangan bisnis ritel,karena sebagian penduduknya adalah pendatang yang mempunyai kesibukan tersendiri,misalnya adalah sekolah,kuliah,dan kerja.Dengan adanya minimarket seperti Tunas Harapan Jaya maka akan sangat membantu mereka para pendatang,dan sebaliknya bagi Tunas Harapan Jaya akan cepat berkembang karena pertumbuhan penduduk Jambi, khususnya di daerah Kebun Kopy sangat cepat dan juga modern sehingga kemungkinan masyarakat untuk berbelanja di minimarket sangat besar.
      Dalam melakukan pemilihan tempat berbelanja,konsumen akan melihat beberapa dimensi atau faktor-faktor tertentu yang menunjukkan bahwa tempat belanja tersebut dapat memenuhi kebutuhannya baik secara material maupun psikologis yang nantinya akan membawa pada tingkat loyalitas pelanggan terhadap minimarket.Minimarket yang merupakan tempat berbelanja yang sangat diminati oleh konsumen di era modern ini,harus memiliki karakteristik tertentu yang membedakan dengan minimarket atau supermarket lain sehingga konsumen tertarik untuk mengunjunginya dan bertransaksi didalamnya.Demi menarik minat konsumen agar berkunjung dengan sendirinya ke dalam minimarket,maka sebuah minimarket harus membentuk suatu citra yang baik mulai dari segi tampilan fisik, pelayanan hingga suatu citra khas yang telah menjadi konsep minimarket tersebut.
      Pentingnya sebuah citra minimarket akan membawa perusahaan tersebut kepada kesuksesan dan kelangsungan hidupnya.Citra minimarket ini dapat dibentuk melalui berbagai dimensi yang kemungkinan besar akan selalu dilihat oleh para konsumen sebelum mereka berkunjung ke dalam sebuah minimarket.Dimana dengan dibentuknya dimensi-dimensi tersebut diharapkan para konsumen akan tertarik berkunjung ke dalam minimarket dan menjadi loyal terhadap minimarket.Oleh karena itu,dalam kesempatannya penulis melakukan sebuah penelitian dengan tema “Pengaruh Citra Minimarket Terhadap Loyalitas Pelanggan pada Tunas Harapan Jaya”.

      B. Perumusan Masalah
      Dalam memutuskan tempat belanja yang tepat,pelanggan akan melihat bagaimana citra sebuah minirmarket ataupun tempat belanja lainnya sebelum masuk ke dalamnya.Hal ini dilakukan karena pada umumnya pelanggan akan sangat selektif dalam memilih tempat belanjanya demi tujuan menciptakan loyalitas terhadap minimarket. Dari uraian di atas dan berdasarkan pada latar belakang masalah, maka perumusan masalah pada penelitian ini adalah sebagai berikut:
      1.Bagaimana pengaruh dimensi citra minimarket kelengkapan produk terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya? 2.Bagaimana pengaruh dimensi citra minimarket pelayanan terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?
      3.Bagaimana pengaruh dimensi citra minimarket kelengkapan fasilitas terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?
      4.Bagaimana pengaruh dimensi citra minimarket lingkungan fisik terhadap loyalitas pelanggan pada Minimarket Tunas HarapanJaya?
      5.Manakah variabel dimensi citra minimarket yang paling dominan berpengaruh terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya?

      C.Tujuan Penelitian
      Adapun tujuan dari penelitian ini adalah sebagai berikut:
      1.Untuk mengidentifikasi pengaruh dimensi citra minimarket kelengkapan produk terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
      2.Untuk mengidentifikasi pengaruh dimensi citra minimarket pelayanan terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
      3.Untuk mengidentifikasi pengaruh dimensi citra minimarket kelengkapan fasilitas terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.
      4.Untuk mengidentifikasi pengaruh dimensi citra minimarket lingkungan fisik terhadap loya litas pelanggan pada Minimarket Tunas Harapan Jaya.
      5.Untuk mengidentifikasi manakah variabel dimensi citra minimarket yang paling dominan berpengaruh terhadap loyalitas pelanggan pada Minimarket Tunas Harapan Jaya.

      D.Manfaat Penelitian
      Ada beberapa manfaat dari penelitian ini,yaitu:
      1.Peneliti:dapat memperkaya pengetahuan tentang perilaku konsumen,dan mengaplikasikan konsep-konsep dan teori-teori mengenai citra minimarket dan loyalitas pelanggan khususnya pada “Minimarket Tunas Harapan Jaya”.
      2.Perusahaan:hasil penelitian ini dapat digunakan sebagai acuan pihak manajemen Minimarket Tunas Harapan Jaya untuk memenuhi kepentingan perusahaan terutama dalam menciptakan loyalitas pelanggan melalui citra minimarket.
      3.Komunitas akademik:memberikan literatur mengenai citra minimarket dan loyalitas pelanggan,khususnya pada industri ritel (eceran).

      BAB II
      OBJEK DAN METODE PENELITIAN
      A. Objek Penelitian
      Objek penelitian merupakan sesuatu yang menjadi perhatian dalam suatu
      penelitian, objek penelitian ini menjadi sasaran dalam penelitian untuk mendapatkan
      jawaban ataupun solusi dari permasalahan yang terjadi.
      “Objek penelitian menjelaskan tentang apa atau siapa yang menjadi objek penelitian.
      Juga dimana dan kapan penelitian di lakukan. Bisa juga ditambahkan hal-hal lain jika
      di anggap perlu”.
      Dalam penyusunan proposal usulan penelitian ini objek yang menjadi sasaran
      pengamatan penyusunan adalah Kualitas Layanan sebagai variable bebas (variable
      x1) dan Kepuasan sebagai variable bebas (variable x2) sementara objek penelitian
      yang merupakan variabel terikat (Variabel Y) adalah Loyalitas pelanggan, sedangkan
      yang menjadi responden adalah para konsumen minimarket Tunas Harapan Jaya daerah kebun kopi jambi. Penelitian ini di laksanakan di Minimarket Tunas Harapan Jaya.

      B. Metode Penelitian
      Metode penelitian merupakan cara penelitian yang digunakan untuk
      mendapatkan data untuk mencapai tujuan tertentu
      Metode yang digunakan dalam penelitian ini adalah deskriftif dan verifikatif. :
      “metode deskriftif adalah metode yang digunakan untuk menggambarkan atau
      menganalisis suatu hasil penelitian tetapi tidak digunakan untuk kesimpulan yang
      lebih luas”.
      Sedangkan metode verifikatif :
      “metode verifikatif yaitu memeriksa benar tidaknya apa bila di jelaskan untuk
      menguji suatu cara dengan atau tanpa perbaikan yang telah di laksanakan di tempat
      lain dengan masalah yang serupa dengan kehidupan”.

      C. Disain Penelitian
      Dalam penulisan ini, desain penulisan yang penulis teliti adalah mengenai
      “Pengaruh citra minimarket terhadap loyalitas pelanggan pada minimarket tunas harapan jaya. Setelah data di peroleh maka data itu akan diolah dan dianalisis.
      Penelitian deskriptif adalah :
      “Penelitian yang dilaksanakan terhadap variabel mandiri, yaitu membuat
      bandingan atau menghubungkan variabel lain. Dalam pemahaman lain, penelitian
      deskriptif merupakan bentuk penelitian yang menggabungkan kejadian sesungguhnya
      di lapangan tentang objek yang akan di teliti sehingga dapat di capai sesuatu kesimpulan sementara”.
      Adapun penelitian deskriptif ini dilakukan untuk mengetahu gambaran
      sesungguhnya tentang peranan Kualitas Layanan dan kepuasan dalam meningkatkan
      Loyalitas pelanggan pada minimarket Tunas Harapan jaya di kebun kopi jambi.
      Sementara itu penelitian verifikatif adalah merupakan pembuktian untuk
      menguji hipotesis hasil penelitian deskriptif melalui suatu penghitungan statistik
      sehingga di dapat hasil pembuiktian yang membuktikan bahwa hipotesis dapat ditolak
      atau diterima. Adapun objek yang di uji dalam penelitian ini adalah pengaruh
      Kualitas layanan dan kepuasaan terhadap loyalitas pelanggan.
      Langkah-langkah desain penelitian adalah sebagai berikut:
      1. Menetapkan permasalahan sebagai indikasi dari fenomena penelitian, selanjutnya
      menetapkan judul penelitian.
      2. Mengidentifikasi permasalahan yang terjadi.
      3. Menetapkan rumusan masalah.
      4. Menetapkan tujuan penelitian.
      5. Menetapkan hipotesis penelitian berdasarkan fenomena dan dukungan teori.
      6. Menetapkan konsep variabel sekaligus pengukuran variabel penelitian yang
      digunakan.
      7. Menetapkan sumber data, teknik penentuan sampel, dan teknik pengumpulan data.
      8. Melakukan analisis data.
      9. Melakukan pelaporan hasil penelitian.

      D.Populasi dan Sampel.
      1.Populasi
      ”Populasi merupakan wilayah generalisasi yang terdiri atas objek atau subjek yang
      mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk
      dipelajari dan kemudian ditarik kesimpulannya”.
      Populasi dari penelitian ini adalah jumlah pembeli selama tiga bulan terakhir konsumen RT.33 RW.07 Jl.Raden wijaya Kelurahan tehok,kecamatan jambi selatan yaitu
      bulan oktober-desember 2011 berjumlah kurang lebih 80 orang . Pemilihan jumlah
      populasi ini dirasakan cukup mewakili untuk memberikan data yang diperlukan dalam penelitian.
      2. Sampel
      ”Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh populasi tersebut”.
      Kesimpulan dari pengertian tersebut adalah sebagian jumlah dan karakteristik yang
      dimiliki oleh sampel tersebut. Apabila populasinya besar dan memungkinkan peneliti
      tidak dapat mempelajari semua yang ada pada populasi, misalnya karena keterbatasan
      waktu dan dana, maka peneliti dapat menggunakan sampel yang diambil dari
      populasi. Karena sempel tersebut dapat mewakili data yang ada dan membantu
      penulis dalam melakukan penghitungan.

      E.Operasional Variabel
      Operasional variable adalah langkah yang harus dilakukan sebelum
      mengadakan penilaian dan penelitian, hal ini dapat mempermudah dalam melakukan
      penelitian. Operasional variable ini diperlukan untuk menentukan jenis, indikator,
      serta skala dari variable-variabel yang terkait dalam penelitian, sehingga pengujian
      hipotesis dapat dilakukan sesuai dengan judul penelitian mengenai pengaruh citra minimarket terhadap loyalitas pelanggan. Maka variable-variabel yang terkait dalam penelitian ini adalah :
      A.Variabel Bebas / Independent (Variabel X) yaitu :
      X1 = Kualitas Layanan
      X2 = Kepuasan
      Devinisi tentang variabel bebas sebagai berikut :
      “Variabel bebas adalah variabel yang mempengaruhi atau yang menjadi sebab
      perubahannya atau timbulnya variabel dependent (terikat)”.
      B.Variabel Terikat / Dependent (Variabel Y) yaitu Loyalitas Pelanggan.
      devinisi variabel terikat sebagai berikut :
      “Variabel terikat merupakan variabel yang dipengaruhi atau yang menjadi akibat,
      karena adanya variabel bebas”.

      F.Sumber Data
      Jenis data yang digunakan peneliti dalam penelitian mengenai “ pengaruh citra minimarket terhadap loyalitas pelanggan pada minimarket tunas harapan jaya kebun kopi kota jambi.
      1. Data Primer
      devinisi tentang sumber primer sebagai berikut :
      “Sumber primer adalah sumber data yang langsung memberikan data kepada
      pengumpul data”.
      Pengumpulan data primer dalam penelitian ini melalui cara menyebarkan kuesioner
      dan melakukan wawancara secara langsung dengan pihak-pihak yang berhubungan
      dengan penelitian yang dilakukan, dalam hal ini adalah konsumen yang berbelanja
      pada minimarket.

      2. Data Sekunder
      devinisi tentang sumber sekunder sebagai berikut
      “Sumber sekunder adalah sumber data yang diperoleh dengan cara membaca,
      mempelajari dan memahami melalui media lain yang bersumber dari literatur, buku-
      buku, serta dokumen perusahaan”.
      Metode yang digunakan adalah metode deskriptif analisis karena penelitian ini
      berkaitan dengan pendapat atau opini individu akan kinerja manajemen perusahaan.
      Objek penelitian dalam studi kasus ini dititikberatkan pada masalah pemilihan
      Kualitas layanan dan kepuasaan dimana pengambilan data dilakukan secara observasi
      langsung pada divisi pemasaran serta penyebaran kuesioner pada masyarakat secara
      langsung pandangan responden, pengambilan data ini dirasakan cukup mewakili
      untuk kebutuhan pengolahan data yang akan dilakukan peneliti.

      G.Teknik Pengumpulan Data
      Adapun teknik pengumpulan data yang digunakan penulis untuk memperoleh
      data serta informasi yang diperlukan adalah sebagai berikut :
      1. Pengamatan (Observation)
      Merupakan teknik yang menuntut adanya pengamatan dari peneliti baik secara
      langsung ataupun tidak langsung terhadap objek penelitiannya. Hasil dari observasi
      dapat dijadikan data pendukung dalam menganalisis dan mengambil kesimpulan.
      Observasi dalam penelitian ini akan dilaksanakan di minimarket serta para konsumen
      yang berbelanja di minimarket

      2. Kuesioner
      Merupakan teknik pengumpulan data yang di lakuakan dengan cara memberi
      seperangkat pertanyaan atau pernyataan tertulis berbentuk formulir kepada seseorang
      atau sekumpulan orang (responden) untuk mendapatkan jawaban, tanggapan dan
      informasi yang diperlukan oleh peneliti. Peneliti memberikan kuesioner yang berisi
      beberapa pertanyaan yang terkait dengan kualitas layanan dan kepuasaan terhadap
      loyalitas pelanggan pada minimarket koperasi Pegawai Pemerintah Kota Bandung.
      Kuesioner yang digunakan adalah kuesioner tertutup yang telah di beri skor, dimana
      data tersebut nantinya akan dihitung secara statistik.

      3. Wawancara (Interview)
      Merupakan teknik pengumpulan data dengan cara melakukan tanya jawab langsung
      secara lisan dengan pihak-pihak yang dianggap dapat memberikan informasi yang
      sesuai dengan kebutuhan khususnya yang menyangkut pengaruh Kualitas layanan
      dan kepuasan terhadap loyalitas pelanggan. Dalam teknik wawancara ini, penulis
      mengadakan Tanya jawab kepada sumber yang dapat memberikan data atau
      informasi. Informasi itu berupa apa saja yang berkaitan dengan Kualitas layanan dan
      kepuasan terhadap loyalitas pelanggan. Adapun sumber informasi dalam penelitian
      ini adalah pihak marketing perusahaan.

      4. Dokumentasi
      Merupakan proses pengumpulan data dengan mempelajari, menganalisa, dan
      menelaah dokumen-dokumen yang terdapat pada perusahaan berkaitan dengan
      pengaruh Kualitas layanan dan kepuasan terhadap loyalitas pelanggan.

      DAFTAR PUSTAKA.
      Alma, B. 2005. Manajemen Pemasaran dan Pemasaran Jasa. Edisi Revisi. CV. Alfabeta. Bandung.
      Anaz, S. 2007. Pengaruh Kualitas Jasa Pelayanan Terhadap Kepuasan Konsumen Pada Wisata Bahari Lamongan. Skripsi UNNES.
      Kotler, Philip. 2005. Manajemen Jasa. PT. Indeks. Jakarta.
      Pramesti, G. 2008. Solusi Express SPSS 15.0. PT Elex Media Komputindo Kelompok Gramedia. Jakarta.
      Priyatno, D. 2008. Mandiri Belajar SPSS. PT Buku Kita. Yogyakarta.
      Rangkuti, F. 2006. Measuring Customer Satisfaction. PT. Gramedia Pustaka Utama. Jakarta.
      Riduwan, D. 2007. Skala Pengukuran Variabel-Variabel Penelitian. Alfabeta. Bandung.
      Supranto, J. 2001. Pengukuran Tingkat Kepuasan Pelanggan. Edisi Baru. PT. Rineka Cipta. Jakarta.
      Tjiptono, F., dan Chandra, G. 2005. Service Quality and Satisfaction. Andi Yogyakarta
      Usman, H., dan Akbar, P. 2006. Pengantar Statistika. Edisi Kedua. Bumi Aksara Yogyakarta.
      Usman, H. 2008. Analisis Perbedaan Kepuasan Nasabah Sebelum dan Sesudah Menggunakan Layanan Jasa Mobile Banking di Yogyakarta. Skripsi UNAS.
      Usman, H. 2008. Analisis Pengaruh Kualitas Layanan Terhadap Kepuasan Konsumen Pemakai Hotel Jayakarta Yogyakarta. Skripsi UNAS.

      Chayadri sepertinya judulmu mengalami pengulangan dg peserta lain.

      Komentar oleh Rachmat Putra | Januari 26, 2012 | Balas

  142. Analisis penanganan keluhan gangguan PT. PLN cabang kota Jambi

    HASIL PERBAIKAN
    NAMA:MARISSA HUSNA
    NIM:ERC1B009015

    Analisis penanganan keluhan gangguan PT. PLN cabang kota Jambi
    BAB I
    PENDAHULUAN

    1.1 Latar Belakang Penelitian

    Perubahan dalam dunia usaha yang semakin cepat mengharuskan perusahaan untuk merespon yang terjadi, masalah pokok yang dihadapi prusahaaan -perusahaan saat ini adalah bagaimana perusahaan tersebut menarik pelanggan dan mempertahankannya agar perusahaan tersebut dapat bertahan dan berkembang. Perubahan teknologi informasi yang berkembang cepat, megharuskan berbagai perusahaan dapat memberikan solusi yang tepat dan cepat sesuai kebutuhan/keinginan pelanggan, sehingga pelanggan puas dan akan bertahan berlangganan. Untuk menjawab masalah tersebut, pemasaran merupakan salah satu kegiatan pokok yang dilakukan oleh perusahaan untuk mempertahankan
    kelangsungan hidupnya. Dalam pemasaran modern, paradigma pemasaran telah bergeser, tidak hanya menciptakan transaksi untuk mencapai keberhasilan pemasaran tetapi perusahaan juga harus menjalin hubungan dengan pelanggan dalam waktu yang panjang.
    Sebagai perusahaan yang bergerak di bidang pendistribusian/penjualan energi listrik PT. PLN (Persero) dalam meraih keuntungan tidak lagi mengandalkan pada volume penjualan saja.
    Kebutuhan pelanggan perlu diidentifikasi secara jelas, sebagai bagian dari pengembangan produk. Tujuan pendekatan ini adalah untuk melampaui harapan pelanggan dan bukan sekedar memenuhinya. Oleh karena itu diperlukan informasi yang akurat apa kebutuhan dan keinginan pelanggan atas dasar barang atau jasa yang dihasilkan perusahaan. Dengan demikian perusahaan dapat memahami dengan baik perilaku pelanggan pada sasarannya, serta dapat menyusun strategi dan program yang tepat dalam rangka memanfaatkan peluang yang ada, menjalin hubungan dengan setiap pelanggan dan mampu mengungguli pesaingnya.
    Perusahaaan yang ingin berkembang dan mendapatkan keunggulan kompetitif harus dapat memberikan produk berupa barang atau jasa berkualitas dengan harga yang murah, penyerahan lebih cepat, dan pelayanan yang baik kepada para pelanggan daripada pesaingnya. Untuk memenuhi kepuasan pelanggan pada industri jasa, kualitas pelayanan sangat penting dikelola perusahaan dengan baik.
    Kualitas pelayanan merupakan tingkat keunggulan yang diharapkan dan pengendalian atas tingkat keunggulan tersebut untuk memenuhi harapan pelanggan (Wyckof, 1993; dalam Sulistyo, 1999).
    Dalam menciptakan kepuasan pelanggan , perusahaan harus dapat meningkatkan nilai pelanggan. Nilai pelanggan dapat diciptakan melalui kualitas kualitas pelayanan yang diberikan perusahaan kepada para pelanggannya.
    Semakin baik kualitas pelayanan, akan semakin tinggi pula nilai pelanggan terhadap perusahaan tersebut. Tingginya kualitas pelayanan juga tidak lepas dari dukungan internal perusahaan, terutama dukungan dukungan dari sumber daya manusia.
    Dalam meningkatkan nilai pelanggan perusahaan juga tidak bisa melupakan jenis dan mutu produknya. Perusahaan yang jenis produknya sangat inovatif, bermutu tinggi, harga bersaing, sehingga mampu bersaing dengan produk lain yang sejenis, akan dapat menarik lebih banyak pelanggan. Semakin inovatif suatu produk, sehingga dapat memenuhi segala kebutuhan pelanggan, maka akan semakin tinggi pula kepuasan pelanggan.
    PT PLN (Persero) sebagai BUMN yang besar yang menjalankan usaha distribusi energi listrik ke pelanggan dituntut untuk menjaga citra perusahaan jangan sampai terjadi implikasi negatif yang dapat mengurangi kepercayaan pelanggan kepada perusahaan, yang akhirnya akan mengurangi citra perusahaan dimata pelanggannya. Sebagai perusahaan yang sekaligus menyediakan produk / jasa, PT. PLN (Persero) harus dapat memberikan kualitas pelayanan yang prima, yaitu pelayanan yang sangat baik dan melampaui harapan pelanggan sehingga dapat memuaskan para pelanggannya secara lebih baik, yang pada gilirannya dapat menumbuhkan loyalitas pelanggan, sehingga terjadi pembelian ulang.
    Selain memberikan pelayanan yang ekselen (prima), PT PLN (Persero) menerapkan upaya-upaya untuk mencapai nilai pelanggan yang berkualitas, kepuasan pelanggan dan loyalitas pelanggan untuk mencapai keuntungan perusahaan.
    Disisi lain kualitas pelayanan merupakan salah satu faktor kunci bagi keberhasilan PLN. Tidak ada yang lebih penting selain menciptakan kepuasan pelanggan PLN melalui pelayanan sebagai salah satu komitmen. Jika pelayanan yang diberikan kepada pelanggan PLN semakin baik akan mempengaruhi kepuasan pelanggan.
    PT. PLN (Persero) sebagai salah satu perusahaan penyedia energi dan mendistribusikan (atau menjual) pada pelanggan, walaupun tidak ada pesaingnya (monopoli) ditingkat hilir atau retail hingga ke tangan pelanggan, tapi menjadi suatu kewajiban bagi perusahaan untuk memberikan nilai pelanggan (customer value), relatif murah harganya (percieved price) dan meningkatkan citra perusahaan (corporate image) serta terus meningkatkan kualitas pelayanan (service quality) yang maksimal. Apabila empat variabel tersebut dilaksanakan dengan baik, maka akan mempengaruhi kepuasan pelanggan (customer satisfaction) listrik.
    PT. PLN (Persero) Unit Pelayanan dalam melaksanakan/menjalankan bisnis inti atau bisnis lain yang terkait harus mematuhi aturan atau ketentuan yang telah digariskan oleh PT. PLN (Persero). Dengan demikian bisnis yang dijalankan tersebut benar-benar terukur, apakah bisnis (kinerja/prestasi kerja) tersebut berhasi atau tidak tercapai ?

    1.2 Rumusan Masalah

    Kualitas pelayanan memiliki hubungan yang erat dengan kepuasan
    pelanggan. Kepuasan pelanggan akan timbul setelah seseorang mengalami
    pengalaman dengan kualitas pelayanan yang diberikan oleh penyedia jasa dalam penanganan keluhan.
    Di PT PLN (Persero) Unit Pelayanan masih dijumpai adanya perbedaan (gap) mengenai kepuasan pelanggan antara yang diharapkan pelanggan dengan realita kinerja pelayanan yang diberikan oleh perusahaan.
    Hal ini dapat terbukti dengan terus meningkatnya jumlah keluhan dari pelanggan yang berkaitan dengan kualitas pelayanan yang diberikan oleh PT.PLN (persero) unit pelayanan kepada pelanggan yang berhubungan dengan waktu pemadaman listrik yang relative lama dan seringnya terjadi pemadaman.
    Berdasarkan latar belakang masalah yang telah dikemukakan diatas dapat dirumuskan masalah sebagai berikut:
    1. Bagaimana tingkat harapan pelanggan dan kinerja Nilai Pelanggan (Customer
    Value) PT PLN (Persero) Unit Pelayanan bagi pelanggan ?
    2. Bagaimana tingkat harapan pelanggan dan kinerja Persepsi Harga (Perceived
    Price) PT PLN (Persero) Unit Pelayanan ?
    3. Bagaimana tingkat harapan pelanggan dan kinerja Citra Perusahaan
    (Corporate Image) PT PLN (Persero) Unit Pelayanan ?
    4. Bagaimana tingkat harapan pelanggan dan kinerja Kualitas Pelayanan (Service
    quality) PT PLN (Persero) pada penanganan keluhan gangguan bagi pelanggan ?

    1.3 Tujuan Penelitian

    Dengan dirumuskannya sebuah penelitian, maka untuk dapat menjawab masalah tersebut ditetapkan beberapa tujuan penelitian, yaitu :
    1. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Nilai
    Pelanggan (Customer Value) PT PLN (Persero) Unit Pelayanan bagi pelanggan.
    2. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Persepsi Harga
    (Perceived Price) PT PLN (Persero) Unit Pelayanan bagi pelanggan.
    3. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Citra
    Perusahaan (Corporate Image) PT PLN (Persero) Unit Pelayanan bagi pelanggan.
    4. Untuk menganalisis seberapa besar tingkat harapan dan kinerja Kualitas
    Pelayanan (Service quality) PT PLN (Persero) pada penanganan keluhan gangguan bagi pelanggan.

    1.4 Manfaat Penelitian.
    Manfaat penelitian ini mengembangkan ilmu pengetahuan dalam strategi khususnya dalam bidang pemasaran perusahaan.
    1. Secara praktis memberikan sumbangan informasi dan bahan masukan bagi
    perusahaan untuk menentukan langkah kebijakan yang tepat dalam usahanya
    untuk memberikan pelayanan yang sesuai dengan harapan pelanggan dan penanganan keluhan gangguan.
    2. Secara teoritis penelitian ini diharapkan dapat memberikan kontribusi dan rujukan empiris yang memperkuat teori yang menyatakan bahwa pelayanan dapat dikatakan berkualitas, apabila dapat memnuhi harapan (kepentingan) dan kebutuhan pelanggan.
    3. Hasil penelitian ini dapat menjadi inspirator bagi peneliti-peneliti lain untuk melakukan penelitian serupa pada agenda penelitian mendatang dengan menggunakan pendekatan variabel-variabel penelitian lain yang menjadi kebijakan yang dijalankan oleh perusahaan.

    BAB II
    METODE PENELITIAN

    2.1 Populasi
    Menurut Sugiyono (1999), populasi adalah wilayah generalisasi yang terdiri atas obyek/subyek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulan.
    Populasi dalam penelitian ini adalah pelanggan PT PLN (Persero) di Kelurahan Pasir Putih.

    2.2 Sample
    Menurut Sudarwan Danim (1997), sample adalah elemen-elemen populasi yang dipilih atas dasar kemampuan mewakilinya.
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 50 RT dan keterbatasan waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 10 RT koresponden yang terdapat dalam populasi tersebut. sampel yang digunakan dalam penelitian ini dilakukan dengan menyebarkan kuesioner ke seluruh koresponden pelanggan PT PLN (Persero).

    DAFTAR PUSTAKA

    http://eprints.undip.ac.id/24065/

    google.com

    http://tatangmanguny.wordpress.com/2009/06/25/sampel-sampling-dan-populasi-penelitian-1/

    Komentar oleh MARISSA HUSNA | Januari 23, 2012 | Balas

  143. Nama : Ricky Ikhwansyah
    NIM : ERC1B009026
    Kelas Sore
    Judul
    “Analisis Kepuasan Nasabah Terhadap Pelayanan PT. Asuransi Sinar Mas Cabang Jambi”.

    BAB I PENDAHULUAN

    1.1. Latar Belakang
    Krisis moneter yang terjadi di Indonesia telah memicu persaingan yang ketat pada berbagai bidang usaha untuk menpertahankan kelangsungan hidupnya. Salah satu industri yang mengalami persaingan ketat ini adalah industri jasa asuransi, dimana kepercayaan masyarakat terhadap jasa asuransi nasional semakin lemah terutama karena kurangnya kepuasan pelayanan nasabah/konsumen.
    PT. Asuransi Sinarmas adalah sebagai salah satu asuransi di kota jambi yang menghadapi dunia persaingan antar asuransi merasa perlu untuk mengeluarkan produk-produk spesifik dan juga inovatif agar dapat lebih unggul dari pada pesaingnya.
    Perkembangan dunia usaha akhir-akhir ini ditandai dengan semakin tajamnya persaingan yang ada, terutama antar perusahaan yang menghasilkan produk-produk sejenis. Hal ini mengakibatkan perusahaan berlomba-lomba menawarkan produknya kepada pelanggan potensial. Pelanggan memang harus dipuaskan, sebab kalau mereka tidak puas akan meninggalkan perusahaan dan menjadi pelanggan pesaing. Hal ini akan menyebabkan penurunan penjualan dan pada akhirnya akan menurunkan laba dan bahkan kerugian.
    Setiap perusahaan yang beorientasi pada keuntungan selalu mengharapkan profit dari usaha yang mereka keluarkan, profit tersebut digunakan baik untuk eksistensi maupun ekspansi dari perusahaan juga untuk kesejahteraan stake holder. Perbedaan yang ada di dalam perusahaan berupa keunggulan-keunggulan selalu digunakan dalam menghadapi pesaing di dalam industri yang sama, keunggulan tersebut digunakan untuk memperoleh kepuasan nasabah sehingga dapat mendatangkan profit bagi perusahaan. Profit yang di dapat oleh perusahaan adalah dari konsumsi produk atau jasa perusahaan oleh nnasabah Kepuasan tersebut dapat terbentuk bila perusahaan mampu memberikan produk barang atau jasa sesuai dengan harapan nasabah. Salah satu cara untuk memberikan kepuasan kepada konsumen/nasabah yaitu dengan meningkatkan pelayanan.
    Kesadaran akan kepusaan nasabah tersebut memyebabkan perusahaan untuk meningkatkan kualitas pelayanannya dengan mempersepsikan bobot kepentingan serta tingkat kinerja dan pelyanan yang berbeda dari setiap nasabah yang diikuti dengan adanya upaya menggali informasi dari nasabah. Kualitas produk atau jasa yang diberikan perusahaan dan kepuasan nasabah berhubungan erat dengan keuntungan yang akan di dapat oleh perusahaan, karena dengan kualitas produk yang memenuhi preferensi nasabah akan mengikat nasabah sehingga perusahaan tersebut tertanam dalam benak nasabah hal ini tentunya menguntungkan bagi pihak perusahaan karena nasabah dapat saja melakukan getok tular kepada teman, keluarga ataupun kepada orang lain untuk mengkonsumsi produk atau jasa dari perusahaan tersebut.
    Dalam dunia usaha secara umum dikenal tiga jenis perusahaan yaitu perusahaan dagang, perusahaan jasa, perusahaan industry. Semua usaha tersebut mempunyai tujuan yang sama yaitu memperoleh laba (Keuntungan) yang sebesar-besarnya dan mempertahankan kelangsungan hidup perusahaan. Untuk mencapai tujuan tersebut maka perusahaan melakukan berbagai cara antara lain meningkatkan volume produksi, menekan biaya produksi, serta meningkatkan volume penjualan.
    Upaya peningkatan volume penjualan harus dilakukan dengan strategi-strategi yang menggunakan konsep pemasaran. Dimana konsep pemasaran merupakan falsafah bisnis yang menyatakan bahwa kepuasan kebutuhan konsumen merupakan syarat ekonomi dan sosial bagi kelangsungan hidup perusahaan.
    Kebutuhan konsumen akan dipenuhi tentunya dengan melakukan aktivitas pemasaran yang tepat, pemasaran yang dilakukan tentunya dengan menjalankan aktivitas yang dikenal dengan Marketing Mix. Salah satu dari elemen Marketing Mix adalah promosi. Dalam melakukan promosi tentunya perusahaan dihadapkan pada anggaran yang digunakan untuk kebutuhan perusahaan tersebut, termasuk promosi pada perusahaan asuransi.
    Saat ini asurasi di Indonesia belum menjadi sesuatu yang sangat penting bagi masyarakat karena asuransi merupakan kategori Unsought yang tidak terpikirkan oleh masyarakat pada umumnya. Tetapi jasa asuransi mempunyai peranan yang sangat berfungsi baik dan sehat bagi suatu perekonomian Negara. Perusahaan jasa dalam suatu perekonomian mutlak diperlukan untuk meningkatkan kualitas hidup masyarakat, karena itu jasa yang bisa dinikmati masyarakat semakin meningkat jumlah dan jenisnya.
    Saat ini banyak perusahaan swasta yang bergerak dibidang jasa, dimana jasa merupakan produk yang bersifat intangible dan bervariasi serta tidak menyebabkan munculnya kepemilikan atas benda tersebut.
    Menurut Yazid (2005, hal 89) bentuk-bentuk perusahaan jasa yang perkembangannya cukup pesat saat ini antara lain:
    1. Bisnis Jasa : Konsultan, Keuangan dan Perbankan
    2. Perdagangan Jasa : Eceran, Pemeliharaan dan Perbaikan
    3. Jasa Infrastruktur : Komunikasi dan Transportasi
    4. Jasa Personal dan Sosial : Restoran dan Perawatan Kesehatan
    5. Administrasi Umum : Pendidikan dan Pelatihan
    Salah satu perusahaan jasa tersebut adalah usaha asuransi yang merupakan usaha jasa keuangan dengan menghimpun dana masyarakat melalui pengumpulan premi asuransi yang mana dengan itu akan memberikan perlindungan kepada anggota masyarakat pemakai jasa asuransi tersebut terhadap kemungkinan timbulnya kerugian karena suatu peristiwa yang tidak pasti atau terhadap hidup atau meninggalnya seseorang.
    Akan tetapi sesuai dengan peningkatan taraf ekonomi dan perusahaan pola hidup masyarakat akan menyadari akan pentingnya asurasi dalam tatanan kehidupan rumah tangga, baik menghadapi resiko yang mendasar seperti kematian, atau dalam mengahadpi resiko atas harta yang dimiliki. Demikian pula dunia usaha dalam menjalankan kegiatanya mengahadapi berbagai resiko yang mungkin dapat menggangu kesinambungan usahanya.
    Walaupun banyak metode untuk menangani resiko, namun asuransi merupakan metode yang paling banyak dipakai. Asuransi menjanjikan perlindungan kepada pihak tertanggung terhadap resiko yang dihadapi perorangan maupun resiko yang dihadapi perusahaan. Disamping itu, usaha perasuransian sebagai salah satu lembaga keuangan menjadi lebih penting peranannya karena dari kegiatan perlindungan resiko, perusahaan asuransi menghimpun dana investasi dalam jumlah yang memadai. Untuk itu diperlukan usaha pengarahan dana masyarakat. Dengan peranan asuransi tersebut dalam perkembangan pembangunan ekonomi yang semakin meningkat, maka semakin terasa kebutuhan akan hadirnya perasuransian yang kuat dan diandalkan.
    Persaingan industri jasa asuransi kerugian itu sendiri semakin kompetatif seiring dengan perkembangan industri jasa di provinsi jambi, khusnya di kota jambi yang ditandai dengan bertambahnya perusahaan asuransi yang akan menyebabkan semakin ketatnya persaingan usaha dibidang tersebut. Untuk dapat bertahan dan dapat mengembangakan usahanya dalam kondisi persaingan yang ketat maka diperlukan strategi pemasaran yang tepat. Pemasaran merupakan salah satu kegiatan pokok perusahaan dalam mempertahankan kelangsungan hidup perusahaan dan mendapatkan laba yang maksimal. Oleh karena itu semua divisi dalam perusahaan mengacu pada pemasaran sebagai suatu sistem utama untuk memonitor berbagai peluang, mendeteksi keberadaan pesaing dan perusahaan dalam pasar, memahami selera konsumen dalam mengembangkan usaha.
    Dalam mengahadapi persaingan, perusahaan asuransi tersebut memrlukan berbagai macam strategi, dianaranya strategi bauran pemasaran dan bauran pemasaran jasa. Bauran pemasaran terdiri 4 (empat) elemen yaitu:
    1. Produk
    2. Price
    3. Place
    4. Promosi,
    yang pada mulanya menjadi bauran pemasaran barang perlu diperluaskan menjadi 7 P jika ingin digunakan dalam jasa.
    Elemen-elemen bauran pemasaran jasa tersebut adalah:
    1. Produk
    2. Price
    3. Place
    4. Promosi
    5. People
    6. Phsysical evidence (bukti fisik) yaitu lingkungan fisik dimana jasa diberikan
    7. Proses
    Pemasaran jasa terutama jasa asuransi erat kaitannya dengan people dan proses. Kedua elemen ini dilakukan oleh induvidu yang dikenal dengan “Personal Selling”.
    Personal Selling sebagai bagian dari kegiatan pemasaran yang sangat di butuhkan, terutama dalam kondisi persaingan diantara sesame perusahaan yang menghasilkan produk sejenis. Terlebih lagi pada penjualan jasa asuransi yang memiliki persaingan yang cukup ketat, hal ini diperlukan promosi yang tepat, dan membutuhkan biaya yang cukup besar serta mengunakan metode dalam promosinya. Karena dengan terlaksananya kegiatan personal selling diharapkan dapat mencapai tujuan yang diinginkan.
    Salah satu dari perusahaan asuransi yang ada di kota jambi tersebut adalah Asuransi PT. Sinar Mas. Perusahaan asuransi sinar mas adalah perusahaan swasta yang bergerak dibidang perdagangan jasa yang lebih mengacu kepada asuransi kerugian seperti asuransi untuk kendaraan untuk bermotor. PT. Asuransi Sinar Mas yang didirikan sejak tahun 1985 ini merupakan anak dari perusahaan sinar mas group dan memiliki cabang yang tersebar di seluruh wilayah Indonesia.
    Asuransi Sinarmas memiliki berbagai macam jenis produk, produk asuransi yang ditawarkan olehnya antara lain:
    1. MBU (Motor Bisnis Unit)
    2. Heavy Equipment (Asuransi Alat Berat)
    3. Marine Cargo (Asuransi Pengangkutan: Darat, Laut, dan Udara)
    4. SEE (Simas Sehat Executife)
    5. PE (Personal Accident)
    6. SSG (Simas Sehat Gold)
    7. SSC (Simas Sehat Corporate)
    8. FIRE (Asuransi Kebakaran)
    Dalam menciptakan penjualan sebesar yang diharapkan perusahaan, maka pimpinan harus mampu merencanakan, menetapkan, dan memperhatikan berbagai faktor yang di anggap dapat meningkatkan volume penjualan asuransi kerugian.
    Dalam pemasaran jasa, pelayanan merupakan salah satu variabel untuk mempertahankan dan meningkatakan jumlah pelanggan. Tujuan dari pelayanan adalah untuk memberikan kepuasan kepada pelanggan dan harapan pelanggan memiliki peranan yang besar sebagai standar perbandingan dalam evaluasi kualitas maupun kepuasan. Kebutuhan pelanggan diusahakan untuk dipuaskan dalam segala aspek, termasuk didalamnya harga, keamanan dan tepat waktu. Oleh karena itu segala aktivitas perusahaan harus dikoordinasikan untuk memuaskan para pelanggan. Semakin tinggi nilai yang diberikan maka semakin besar pula kepuasan pelanggan.
    Setiap pelanggan memiliki tingkat kepuasan yang berbeda, maka setiap pelanggan mempunyai penilaian yang beda pula terhadap pelayanan yang mereka terima. Apabila pelanggan telah membeli dan menikmati layanan yang telah diberikan namun keinginan untuk dilayani tidak terpenuhi, maka akan berakibat negative terhadap pelanggan yang potensial setelah mendengarkan pendapat yang dilontarkan oleh pelanggan terdahulu. Hal ini merupakan salah satu penyebab terjadinya penurunan jumlah pelanggan. Manajemen harus berusaha memberikan pelayana yang baik untuk memberikan kepuasan yang maksimal kepada pelanggan, karena kepuasan yang maksiamal kepada pelanggan, karena kepuasan pelanggan merupakan tolak ukur dari kualitas pelayan yang diberikan.

    1.2 Identifikasi Masalah
    Pada hakekatnya tujuan bisnis adalah untuk menciptakan dan mempertahankan pelanggan, sehingga kepuasan pelanggan menjadi prioritas utama dalam perusahaan. Untuk itu perusahaan harus memiliki fokus kepada pelanggan. Kunci untuk membentuk fokus kepada pelanggan dan memperdayakan mereka untuk mengambil tindakan yang perlukan dalam rangka memuaskan para pelanggan.
    Untuk dapat mempertahankan dan meningkatkan kepuasan pelanggan yang telah dicapai saat ini. Upaya ini dilakukan denagan mencari informasi langsung dari pelanggan dalam format tertentu yang dapat dikuantifikasikan. Hal ini sangat penting dengan semakin bergesernya pendekatan system pemasaran dari system berorientasi laba kearah system berorientasipelanggan (Kotler, 1995 hal 34).
    Didalam memasarkan produk atau jasa pelayanan adalah salah satu factor penunjang keberhasilan pemasaran. Oleh karena itu pelanggan memiliki arti penting bagi perusahaan, dalam hal ini perusahaan harus memandang kegiatan-kegiatan pelayanan dari sudut pandang konsumen dan juga berusaha mengenali serta memahami serangkaina kebutuhan dan keinginan konsumen, karena usaha pelayanan jasa yang mingingkan respon yang baik dari pelanggan membutuhkan komitmen dan tindakan nyata dalam memberikan pelayanan yang berkualitas kepada pelanggan.
    Adapun identifikasi masalah dalam penelitian ini adalah:
    1. Bagaimana tingkat respon nasabah terhadap pelayanan PT. Asuransi Sinar Mas Cabang Jambi
    2. Bagaimana pelayanan PT. Asuransi Sinar Mas Cabang Jambi
    3. Bagaimana kualitas produk PT. Asuransi Sinar Mas Cabang Jambi
    4. Bagaimana kepuasan nasabah terhadap produk PT. Asuransi Sinar Mas Cabang Jambi

    1.3. Rumusan Masalah
    Untuk bisa memahami kebutuhan pelanggan, perusahaan membutuhkan respon dari pelanggan. Dengan memahami kebutuhan pelanggan perusahaan akan dapat memberikan yang terbaik kepada pelanggan.
    Jumlah pelanggan tentu sangat berpengaruh terhadap perkembangan perusahaan, karena semakin banyak jumlah pengajuan perlindungan asuransi kerugian pasti mempengaruhi pendapatan bagi perusahaan, hubungan timbale balik yang dibangun antara perusahaan dan pelanggan sangat perlu mendapat perhatian khusus bagi perusahaan.
    Untuk bisa meningkatkan jumlah pelanggan hal yang paling penting diperhatikan perusahaan adalah kebutuhan dan kemampuan pelaggan, pemahaman perusahaan terhadap indikasi vital ini akan memberikan dampak terhadap penambahan omset perusahaa, maka perlu sekali diketahui respon dari pelanggan terhadap semua factor termasuk kebijakan dan pelayanan yang diberikan oleh perusahaan.
    Peningkatan kinerja, pelayanan yang mudah dan nyaman serta strategi bisnis yang menarik menjadi kunci utama bagi perusahaan, dan itu semua diawali denagan mengenali respon yang diberikan terhadap kebijakan dan strategi bisnis dan perusahaan.
    Oleh karena itu pelanggan memiliki arti penting bagi perusahaan, dalam hal ini perusahaan harus memandang kegiatan-kegiatan pelayana dari sudut pandang konsumen dan juga berusaha mengenali dan memahami serangkaian kebutuhan dan keinginan konsumen, karena usaha pelayanan jasa yang bertujuan kepada kepuasaan membutuhkan komitmen dan tindakan nyata dalam memberikan pelayanan yang berkualitas pada pelanggan.
    Berdasarkan hal diatas, maka yang menjadi permasalahan dalam penelitian ini adalah “Bagaimana kepuasan nasabah terhadap pelayanan PT. Asuransi Sinar Mas Cabang Jambi“ ?

    1.4. Tujuan dan Manfaat Penelitian
    1.4.1. Tujuan penelitian
    1. Untuk mengetahui kepuasan nasabah terhadap pelayanan PT. Asuransi Sinar Mas Cabang Jambi
    2. Untuk menganalisa kepuasan dari pelanggan terhadap PT. Asuransi Sinar Mas Cabang Jambi

    1.4.2. Manfaat Penelitian
    Adapun manfaat yang diharapkan penulis daam penelitian adalah:
    1. Penelitian ini akan bermanfaat bagi PT. Asuransi Sinar Mas Cabang Jambi dalam membuat kebijaksanaan perusahaan dalam melayani kebutuhan pelanggan
    2. Penelitian ini dapat dijadikan sebagai bahan informasi dan literature ilmiah dalam penelitian lebih lanjut tentang strategi bisnis Asuransi
    3. Bagi peneliti dapat menambah wawasan dan memperluas pengetahuan

    BAB II METODOLOGI PENELITIAN
    2.1.Lokasi Penelitian
    Penelitian ini dilaksanakan pada PT. Asuransi Sinar Mas yang berlokasi berada di kawasan Jl. Hayam Wuruk No. 28 yang berada di Provinsi Jambi.

    2.2.Populasi dan Sampel
    2.2.1.Populasi Penelitian
    Untuk memperoleh data dan informasi yang di perlukan, penlitian ini mengunakan metode survey yaitu dengan melakukan penelitian langsung terhadap pihak-pihak tertentu yang termasuk komponen-komponen yang berhubungan dengan kegiatan penelitian yang dilakukan.

    2.2.2.Sampel Penelitian
    Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 50 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat.

    2.3.Jenis pengumpulan data
    1.Jenis Data
    Jenis data dalam penelitian ini berupa :
    a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, skema, dan gambar, sepertu literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
    b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).

    2.4.Sumber Data
    Sumber data dalam penelitian ini berupa :
    a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.
    b.Data Sekunder, yaitu data yng diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari situasi-situasi internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.

    Daftar Pustaka

    Yazid, (2003), Pemasaran Jasa, Konsep dan Implementasi. Ekonisia, Yogyakarta.
    Kotler. P, (1995), Manajemen Pemasaran, Analisis, Rencana, Implementasi dan Pengendalian. Jilid I dan II. PT. Prenhalindo. Jakarta.
    Arikunto,Suharsimi.2002. Prosedur Penelitian.Edisi Revisi V.PT.Rineka Cipta.Jakarta.

    Komentar oleh Ricky Ikhwansyah | Januari 24, 2012 | Balas

  144. Nama :irma suryati
    Nim : c1b009139
    kelas : mgt G pagi 09

    salam pak jo,
    ini proposal tentatif saya pak, yang berkaitan dengan sampel, populasi dan daftar pustaka……

    Bab III

    3.1 Obyek / Populasi Penelitian
    Dalam penulisan skripsi ini yang menjadi obyek penelitian adalah swalayan enha sipin kota jambi. Sedangkan untuk subyek/populasi dari penelitian ini adalah pengunjung atau pelanggan swalayan enha.

    3.2 Jenis Data
    a. data primer
    Data primer merupakan data yang diperoleh dari sumber pertama yaitu, responden, pimpinan dan karyawan swalayan enha. Penelitian ini diperoleh dengan cara menyebarkan kuisioner ke pengunjung swalayan enha.
    b. data sekunder
    Merupakan data yang diperoleh dari pihak manajemen swalayan enha, data data tersebut antara lain:
    1. sejarah singkat perusahaa.
    a. sejarah pendiri swlayan enha.
    b. sejarah berdirinya swalyan enha.
    2. struktur organisasi
    3. tenaga kerja dan pembagian tugas masing-masing bagian

    3.3 Metode Pengumpulan Data
    Untuk memperoleh data yang relevan terhadap penelitian ini, maka penulis menggunakan kuesioner sebagai alat pengumpulan data. Kuesioner diberikan secara langsung pada responden.

    3.4 Teknik penarikan Sampel
    Penarikan sampel dilakukan dengan cara conviniance sampling, hal ini dikarenakan populasi jumlah pengunjung enha yang sebenarnya sulit untuk diketahui, sehingga peneliti dapat lebih mudah memilih responden untuk dijadikan sampel dalam penelitian ini.
    menurut ari kuntoro dalam sri (2004, hal, 26) jika jumlah subyek diambil besar maka dapat di ambil antara 10% – 15% atau 20 -25%. Dalam penelitian ini peneliti menyebarkan 100 kuisioner yang diberikan pada konsumen yang datang berkunjung. Menurut Guilford (dalam supranto, 1997) jika semakin besar sampel (makin besar nilai n=banyaknya elemen sampel) akan memberikan hasil yang lebih akurat

    DAFTAR PUSTAKA
    http://id.wikipedia.org/wiki/Supermarket
    http://febriirawanto.blogspot.com/2012/01/pengertian-pramuniaga.html
    • Google search

    Komentar oleh irma suryati | Januari 25, 2012 | Balas

  145. ugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore
    Judul : “Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan Im3 Pada PT. INDOSAT Cabang JAMBI”.

    BAB I
    PENDAHULUAN

    1.1. Latar Belakang

    Seiring dengan perkembangan perekonomian di negara Indonesia saat ini, juga pengaruh dari perkembangan teknologi yang menyebabkan perusahaan dalam perkembangannya dituntut untuk lebih kreatif dan inovatif, sehingga membuat semakin ketatnya persaingan dalam dunia bisnis, dengan semakin ketatnya tingkat persaingan maka dibutuhkan pula fungsi pemasaran yang baik, sehingga tujuan yang di harapkan oleh perusahaan akan tercapai, karena pemasaran perupakan pilar utama yang penting dalam kelangsungan hidup perusahaan.
    Perusahan yang unggul adalah mereka yang dengan tangkas menyiasati perubahan bisnis dan dapat memanfatkan peluang-peluang yang ada, serta mereka yang berhasil memberikan kepuasan bagi pelanggannya, tentunya dengan sesuatu hal yang efektif dan efisien, salah satunya melalui komunikasi secara baik bagi pelanggannya, sehingga hubungan antara produsen atau perusahan dengan pelanggannya akan semakin erat dan harmonis.
    Perusahaan membutuhkan komunikasi dengan pelanggannya yaitu dengan cara melakukan promosi, semakin gencar perusahaan melakukan promosi maka akan semakin dekat di benak pelanggannya. Oleh karena itu banyak perusahan yang berani mengeluarkan anggaran yang cukup besar untuk biaya promosi. Media atau alat promosi yang sering dilakukan perusahaan antara lain melalui: periklanan, Penjualan Personal, Pemasaran Langsung, Hubungan Masyarakat, dan Promosi Penjualan, Alat alat promosi tersebut dapat digunakan sesuai dengan kebutuhan dan kemampuan dari perusahaan itu sendiri.
    Berdasarkan uraian di atas, maka penulis tertarik untuk mengadakan penelitian tentang masalah promosi dalam upaya mempertahankan loyalitas pelanggan pada PT.Indosat Cabang Jambi yang merupakan perusahaan yang bergerak di bidang jasa telekomunikasi, penulis akan mencoba membahas mengenai promosi khususnya produk jasa telekomunikasi yang diterapkan perusahaan dengan judul :
    Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan Im3 Pada PT. INDOSAT Cabang JAMBI”.

    1.2. Rumusan Masalah

    Berdasarkan uraian di atas, maka dapat di Rumuskan masalah-masalah pokok sebagai berikut :
    1.) Apa tujuan pelaksanaan promosi pada PT. Indosat Cabang Jambi
    2.) Bagaimana efektifitas promosi untuk memelihara loyalitas pelanggan Im3 pada PT. Indosat Cabang Jambi
    3.) Faktor faktor yang Mendukung dan menghambat efektifitas promosi untuk memelihara loyalitas pelanggan Im3 pada PT. Indosat Cabang Jambi

    1.3. Tujuan Penelitian

    Adapun tujuan penelitian ini adalah untuk mengetahui:
    1.) Tujuan pelaksanaan promosi pada PT. Indosat Cabang Jambi
    2.) Bagaimana pelaksanaan promosi dalam upaya Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan im3 Pada PT.Indosat Cabang Jambi
    3.) Faktor faktor yang mendukung dan menghambat Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan im3 Pada PT.Indosat Cabang Jambi

    1.4. Manfaat Penelitian

    1.) Bagi perusahaan
    Khususnya bagi PT. Indosat Cabang Jambi, hasil penelitian ini diharapkan dapat memberikan sumbangsih pemikiran dan bahan pertimbangan atau masukan dalam memperbaiki serta meningkatkan pelaksanaan promosi yang dilakukan oleh perusahaan dalam Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan im3 Pada PT.Indosat Cabang Jambi.
    2.) Bagi penulis
    Hasil penelitian diharapkan dapat menambah wawasan dan pengetahuan secara teoritis maupun secara praktis juga pengalaman mengenai promosi.
    3.) Bagi pihak lain
    Hasil penelitian ini diharapkan dapat memberikan sumbangan pemikiran yang berarti pada semua pihak, khususnya rekan-rekan mahasiswa dalam melaksanakan penelitian yang berhubungan dengan masalah pelaksanaan promosi di masa yang akan datang.

    Komentar oleh rahmat | Januari 25, 2012 | Balas

  146. PROPOSAL TENTATIF
    “ANALISIS STRATEGI PEMASARAN PADA PENJUALAN RUMAH TOKO DI PERUMAHAN ASTON VILLA JAMBI”
    DOSEN PENGASUH : Dr.JOHANNES SIMATUPANG SE.MM

    DIAJUKAN UNTUK :
    MEMENUHI NILAI AKHIR SEMESTER PADA MATA KULIAH METODE PENELITIAN BISNIS PEMASARAN (125P)

    DISUSUN OLEH :
    NOVITA KURNIAWATI
    C1B009149
    (kelas pagi)

    BAB I
    PENDAHULUAN
    1.1 Latar Belakang

    Kegiatan pemasaran dalam suatu perusahaan merupakan unsur yang penting dalam menjamin keberlangsungan usaha, disamping fungsi-fungsi pemasaran lain seperti : produksi, keuangan, personalia, serta riset dan pengembangan. Didalam aktifitas perusahaan antara bagian pemasaran, keuangan, produksi, personalia satu sama lain harus saling berkoordinasi. Kegiata produksi tidak akan berlangsung jika tidak ada dana, sedangkan dana akan diperoleh jika perusahaan melakukan kegiatan pemasaran produknya.

    Secara umum aktifitas perusahaan adalah untuk memaksimalkan perolehan laba, hal ini penting agar perusahaan dapat berkerlanjutan lain dalam hal produksi, menunaikan kewajiban-kewajiban maupun pengembangan usaha. Laba rugi sebuah perusahaan tidak menjadi sesuatu yang diatas segala-galanya. Perusahhan harus mampu menciptakan suasana yang harmonis antara pihak-pihak yang terlibat dalam aktifitas perusahaan tersebut mulai dari distributor sampai pada konsumen akhir. Manajemen pemasaran menurut kotler, adalah kegiatan penganalisaan, perencanaan, pelaksanaan dan pengemasan program-program yang ditujukan untuk mengadakan pertukaran dengan pasar yang dituju dengan maksud tercapainya tujuan organisasi.

    Aktifitas pemasaran yang dilakukan perusahan harus mengacu pada kemampuan perusahaan iitu sendiri. Pada dasarnya pemasarn merupakan suatu kegiatan yang paling penting dalam suatu perusahaan, karena perusahaan baru dapat tercapai apabila hasil-hasil produksi telah terjual. Agar hasil produksi dapat terjual dan memberikan keuntungan, maka kegiatan pemasaran harus dilaksanakan dengan baik.

    Setiap perusahaan mempunyai tujuan masing-masing yang ingin dicapai, tujuan tersebut dapat berupa usaha untuk meningkatkan volume penjualan, memperbesar market share, memperoleh laba optimal dan mempertahankan kelangsungan hidup perusahaan.

    Keberhasilan sebuah perusahaan dalam memasrkan produk bukanlah hal yang mudah, memasarkan produk itu tidak hanya menjual atau menukarkan dengan sesuatu. Tetapi berusaha memenuhi kebutuhan dan keinginan konsumen. Tercapainya kepuasankonsumen dapat menciptakan hubungan baik antara kedua belah pihak. Untuk memprlajari konsumen tidak hanya mengetahui apa (what ) yang dibelinya saja, tetapi bagaimana (how ) kebiasaan dan dalam kondisi seperti apa barang tersebut dibelinya.

    Dewasa ini banyak perusahaan menggunakan konsep pemasaran dengan tujuan untuk memberikan kepuasan terhadap kebutuhan dan keinginan konsumen atau berorientasi pada konsumen. Kegiatan pemasaran suatu perusahaan harus dimulai denagn usaha mengenal dan merumuskan keinginan dan kebutuhan dari konsumen kemudian merancang strategi pemasarannya. Hal ini sesuai dengan pendapat kotler (1992) yang menyatakan bahwa kunci untuk mencapai sukses tujuan organisasi terdiri dari penentuan kebutuhan dan keinginan pasar sasaran serta memberikan kepuasan yang diharapkan secara lebih efektif dibanding para pesaing.

    Untuk mengetahui keinginan dan kebutuhan konsumen perlu dilakukan kajian mengenai prilaku konsumen, dimana konsumen selaku manusia memiliki karakteristik yang berbeda-beda baik itu menurut usia, pendapatan, tingkat pendidikan, pola perpindahan tempat, selera dan juga cara memandang sesuatu. Dari perbadaan karakteristik yang ada pada konsumen diatas maka menyebabkan ada perilaku konsumen yang bermacam-macam pula. Hal ini menggambarkan berapa besra pentingnya bagi perusahaan untuk mengetahui prilaku konsumen dalam upaya memenuhi keinginan dan kebutuhan konsumen, dan ini akan membentuk prilaku konsumen dalam melakukan pembelian.

    Salah satu kebutuhan pokok manusia yaitu papan atau yang disebut rumah sebagai tempat berlindung dari panas dan hujan. Produk ini dapat diterima masyarakat karena memang perumahan merupakan suatu kebutuhan yang sangat penting bagi konsumen. Namun, karena pertimbangan akan proses pembuatannya yang lama dan membutuhkan biaya yang cukup besar membuat konsumen ingin memperoleh tempat tinggal dengan cara yang praktis dan dengan kemudahan biayanya maka disini pemasar memberikan solusi yaitu dengan memproduksi suatu perumahan yang dapat dibayar dengan kemudahan kredit berjangka.

    Pada saat ini konsumen dapat dengan mudah menemukan berbagai jenis perumahan yang ditawarkan oleh berbagai perusahaan sesuai dengan kebutuhan masing- masing konsumen. Dengan kondisi pasar tersebut perusahaan berusaha menghasilkan produk yang berkualitas, mulai dari produksi sampai produk tersebut berada di tangan konsumen, meningkatkan kualitas produk yang nantinya dapat bersaing dipasaran dengan produk lain.

    Banyaknya jenis perumahan yang ditawarkan oleh pemasar menyababkan tingkat persaingan di industri perumahan menjadi semakin ketat. Baik itu perumahan kualiatas biasa maupun perumahan kualitas tinggi dengan fasilitas, tempat, keamanan, dan fasilitas lain yang mendukung suatu keingina konsumen terhadap perumahan tersebut.
    Sejak Pemerintah Kota Jambi melakukan pelebaran pada jalan Patimura menjadi dua jalur, laju perkembangan Kota Jambi di arah barat sangat pesat dan luar biasa. Di seputaran pertigaan Simpang Rimbo, misalnya, di setahun belakangan ini laju pertumbuhannya sangat meroket. Bahkan daerah ini bisa dibilang sebagai pusat pertumbuhan.

    “Pertumbuhan pembangunan di wilayah barat di Kota Jambi pada tahun belakangan ini memang saat pesat. Karenanya tepat sekali bila PT NGK mendirikan perumahan di sini.

    ASTON VILLA, yang berlokasi hanya 100 meter dari lampu merah simpang Aurduri, 3 menit ke UNJA, 6 menit ke IAIN serta 20 menit ke Tugu Juang Sipin ,tidak salah lokasi ini merupakan lokasi yang strategis secara geografis berada di area lingkungan akademis yang bergengsi, sehingga tak luput menjadi pilihan para konsumen sebagai dampak dari tingginya market Valencia.

    Infra Struktur jalan aspal, fasum lapangan Futsal, taman, fasos sarana Ibadah Mesjid telah dibangun, listrik, air PDAM telah siap untuk disambungkan kesetiap unit rumah karena jaringan sudah tersedia.
    Aston Villa hadir dengan konsep perumahan yang telah mengantisipasi laju perkembangan daerah seperti pembuatan jalan lingkungan dalam yang memiliki lebar 8 meter. Aston Villa juga didukung dengan keberadaan puluhan pertokoan.
    Untuk menyudiakan produk rumah yang memadai dengan harga yang terjangkau perusahaan telah membangun sebuah proyek perumahan aston villa yang menyediakan berbagai tipe rumah dengan harga tertentu separti tipe T 29 ( RSH lantai keramik) dengan harga Rp 55 jt, T 36 dengan harga Rp 84 jt-an, Tipe 45 harga Rp 112 jt-an, dan pertokoan K 36 dengan harga Rp 99 jt-an. Kesemua tipe tersebut dapat konsumen peroleh dengan cara bayar yang sangat ringan dan terjangkau. Namun demikian selam tiga tahun terakhir kegiatan penjualan perumahan aston villa ini tidak menunjukkkan kenaikan penjualan yang signifikan sehingga pada saat ini perumahan aston villa masih sepi penghuni begitu juga dengan tipe rukonya yang sampai saat ini hanya 40% dihuni.
    Ihwal fasilitas di dalam lingkungan, selain sudah dilengkapi fasilias utama, seperti air dan listrik, Aston Villa telah memiliki berbagai taman yang asri yang sangat menunjang keindahaan lokasi. “Untuk sarana dan prasana, tentu sebagai pengembang selalu menempatkan hal tersebut sebagai yang utama. Jadi semua fasilitas telah siapkan,” tambah Kustiwa yang menambahkan akan terus melakukan berbagai program promosi untuk mendongkrak penjulan Aston Villa.
    Perumahan aston villa memiliki banyak pesaing seperti perumahan perumahan aurduri, perumahan bahri makmur, perumahan puri masurai dan perumahan lain yang berada disekitarnya. Bahkan dari proyek lain dari PT.NGK sendiri yaitu perumahan Valencia yang baru di jalankan kurang lebih 2 tahun yang lalu sudah 90% terjual.

    Dengan banyaknya pilihan akan jenis perumahan, maka konsumen memiliki berbagai jenis pilihan perumahan yang mereka sukai. Untuk itu perusahaan dituntut untuk tahu apa kebutuhan dan keinginan konsumen, agar perusahaan dapat menciptakan perumahan dengan kualitas yang baik, fasilitas yang memadai, menarik yang diinginkan oleh konsumen.

    Dalam penelitian ini penulis hanya membahas salah atu produk perumahan dari aston villa yaitu rumah toko (ruko) yang diproduksi oleh PT. Niaga Guna Kencana. Aston villa mulai di produksi pada tanun 2008, terdapat berbagai jenis perumahan termasuk rumah toko yang ditwarkan oleh perusahaan ini. Namun, sampai pada tahun 2011 perumahan tersebut belum dapat mencapai target penjualannya sehingga sampai saat ini perumahan tersebut masih sepi penghuni atau belum terjual sepenuhnya.

    Berdasarkan uraian diatas penulis tertarik untuk melakukan penelitian yang berhubungan dengan perilaku konsumen terhadap produk perumahan ruko pada aston villa tersebut. Dalam penelitian ini penulis juga mengambil penduduk yang telah menghuni rumah toko di aston villa tersebut sebagai objek penelitian untuk mengetahui bagaiman perilaku konsumen terhadap pemilihan produk perumahan tersebut.

    Maka judul dari penelitian ini adalah “ Analisis strategi pemasaran pada penjualan rumah toko di perumahan Aston Villa Jambi.”

    1.1 Perumusan Masalah

    JAMBI – Ekspansi menjadi perhatian yang sangat serius bagi PT Niaga Guna Kencana (NGK). Developer ini sekarang menjelma menjadi patokan/referensi bagi masyarakat Jambi ketika akan membeli rumah. Dalam kiprahnya yang sudah memasuki tahun kelima, telah meluncurkan 11 proyek perumahan dan bangunan komersial. Proyek-proyek yang masih dipasarkan saat ini antara lain Villa Gading Mayang (SOLD OUT), Barcelona Regency (tinggal 1 unit), Atalanta Regency, Aston Villa, Liverpool Estate, Parma Residence, Arsenal Estate dan Valencia. Dalam bulan ini NGK juga akan meluncurkan proyek perumahan di jalan Baru Pipa dekat SMP 16 Mayang.

    Developer ini memang sangat jeli membaca pasar dan sangat akomodatif terhadap trend gaya hidup. Menurut PM NGK Dodi, keunggulan perumahan yang dibangun NGK adalah pemilihan lokasi kompleks perumahan yang sangat strategis, penataan dan konsep perumahan yang baik dan sangat memperhatikan infrastruktur. Secara kasat mata, infrastruktur perumahan NGK seperti jalan, taman, jaringan air bersih, jaringan listrik dan lainya selalu diprioritaskan. Fasilitas tersebut dibangun berbarengan dengan membangun rumah, sehingga ketika konsumen menempati rumahnya, kompleks sudah tertata rapi. Meskipun kadang rumah yang dibangun type kecil, namun suasananya tampak lega dan nyaman.

    perilaku konsumen dalam memilih produk perumahan tipe ruko untuk memuaskan kebutuhan dan keinginan konsumen dipengaruhi oleh beberapa faktor. Faktor keberadaan dimana perumahan tipe ruko tersebut di produksi adalah faktor yang paling mempengaruhi perilaku konsumen terhadap pemilihan perumahan tipe ruko yang memenuhi kebutuhan dan keinginannya. Pada dasarnya Faktor-faktor tersebut adalah faktor yang dapat dikendalikan oleh perusahaan tetapi harus benar-benar di pertimbangkan.

    Saat ini banyak terdapat pilihan produksi perumahan dari yang berada ditengah kota ataupun berada di gerbang kota atau dekat dengan fasilitas-fasilitas pendidikan. Semua itu ditawarkan untuk memenuhi kebutuhan dan keinginan konsumen. Untuk itu pemahaman mengenai prilaku konsuman sangatlah penting , karena bnyak perubahan-perubahn yang secara terus-menerus terjadi di pasar. Perubahan-perubahan tersebut banyak terjadi karena banyaknya pilihan dari berbagai produk perumahan yang menawarkan dengan tempat, fasilitas, keamanan yang berbeda-beda yang secara terus menerus bertambah di pasaran. Sehingga semakin gencarnya kehadiran produk baru akan semakin meningkatkan iklim persaingan sesama produsen.

    Maka yang menjadi permasalahan utama dalam penelitian ini adalah “ strategi seperti apakah yang dijalankan oleh PT.NGK dalam menarik minat konsumen dalam memilih produk rumah tipe ruko di perumahan Aston Villa Jambi?.”

    1.2 Tujuan Penelitian
    Tujuan dilakukan penelitian ini adalah :
    1. Untuk mengetahui apakah variabel tempat, fasilitas pendukung, harga, kondisi, keamanan berpengaruh secara signifikan terhadap perilaku konsumen.
    2. Untuk menganalisis variabel yang berpengaruh dominan terhadap pembelian produk perumahan pada perumahan aston villa jambi.

    1.3 Manfaat Penelitian
    Manfaat dari penelitian ini adalah :
    1. Hasil penelitian ini dapat dijadikan salah satu informasi bagi PT. Niaga kencana khususnya pada produksi perumahan aston villa mengenai perilaku konsumen dalam memilih produk rumah toko yang sesuai dengan kebutuhan dan keinginan konsumen.
    2. Menjadi sumbangan pemikiran secara empiris serta untuk pengembangan ilmu pengetahuan khususnya manajemen pemasaran.

    BAB11
    TINJAUAN PUSTAKA

    2.1 Definisi-Definisi
    William (1995;5) mendefinisikan ilmu ekonomi adalah suatu studi tentang prilaku orang dan masyarakat dalam memilih sumberdaya yang langka dan memiliki beberapa alternatif penggunaan, dalam rangka memproduksi berbagai komoditi, untuk kemudian menyalurkannya baik saat ini maupun dimasa depan kepada berbagai individu dan kelompok yang ada dalam suatu masyarakat.
    Manajemen menurut T. Handoko (2000;3) adalah perencanaan (penetapan apa yang akan dilakukan), pengorganisasian, penyusunan personalia (penarikan, seleksi, pengembangan, pemberian kompensasi dan penilaian prestasi kerja), pengadaan dan pengawasan.
    Menurut sofwan assauri (1990;79) manajemen adalah kegiatan atau usaha untuk mencapai suatu tujuan dengan mengkoordinir kegiatan orang lain.
    Pemasaran menurut philip khotler (1998;5) adalah suatu proses sosial dimana individu dan kelompok mendapatkan apa yang mereka butuhkan dan inginkan dengancara menciptakan dan mempertukarkan produk dan nilai dengan individu dan kelompok lainnya.
    Sedangkan menurut William (1995;5) mengemukakan pemasaran adalah sistem keseluruhan dari kegiatan-kegiatan bisnis yang ditujukan untuk merencanakan, menentukan harga, mempromosikan dan mendistribusikan barang dan jasa yang memuaskan kebutuhan, baik kepada pembeli yang ada maupun kepada pembeli yang potensial.
    Penjualan menurut Basu Swasta (1995;125) adalah suatu ilmu dan seni untuk mempengaruhi pribadi yang dilakukan oleh penjual untuk mengajak orang lain agar bersedia membeli barang dan jasa yang ditawarkan.
    Sedangkan menurut William (1995;8) pengertian penjualan adalah bagian dari promosi. Sedangkan promosi adalah salah satu bnagian dari keseluruhan sistem pemasaran.
    Stategi penjualan menurut Fandy Tjiptono (2000;249) adalah memindahkan lokasi posisi pelanggan ketahap pembelian (dalam proses pengambilan melalaui penjualan tatap muka).
    Target menurut (kamus besar bahasa Indonesia 2000;902) adalah sasaran yang telah ditetapkan untuk dicapai, sedangkan target penjualan adalah sasaran yang ingin dicapai didalam kegiatan penjualan barang dan jasa.
    Perum perumnas adalah penyediaan pelayanan bagi pemanfaatan umum dan sekaligus ini memupuk keuntungan berdasarkan prinsip pengelolaan perusahaan di sektor pengadaan perumahan dan pemukimam terutama bagi golongan masyarakat berpenghasilan menengah kebawah yang menganut prinsip persaingan bebas (menurut pp No.29 tahun 1974).
    Visi dari perusahaan perumahan yaitu menjadi perusahaan yang sehat tumbuh dan berkembang sehingga mampu berperan sebagai penggerak pembangunan perumahan dan pemukiman yang layak dan terjangkau terutama untuk golongan masyarakan berpenghasilan menengah kebawah dalam rangka mendorong pengembangan perkotaan yang terarah.
    Sedangkan misi dari perusahaan perumahan yaitu :
    1. Menggerakan pembangunan perumahan dan pemukiman dalam rangka mendorong pembangunan kota yang terarah dan meningktkan kualitas kehidupan masyarakat.
    2. Melaksanakan kegitan pembangunan perumahan dan pemukiman dikawasan baru maupun peremajaan kawasan yang layak dan terjangkau terutama untuk golongan masyarakat berpengjasilan menengah kebawah dan menciptakan kesempatan usaha dan lapangan kerja.
    3. Memupuk keuntungan berdasarkan prinsip pengelolaan perusahaan yang sehat sehingga dapat tumbuh dan berkembang dalam menjalankan misinya.

    2.2 Kerangka Teoritis
    Suatu perusahaan tidak bertahan bilamana perusahaan tersebut tidak mampu menjual berupa barang atau jasa yang dihasilkannya. Penjualan bukan sekedar memindahkan dari gudang perusahaan ke gudang pembeli dan perusahaan menerima uang dari pembeli sesudah itu selesai, namundidalam penjualan itu terkandung keinginan perusahaan untuk memuaskan konsumen dengan hasil produksinya. Dengan demikian tujuan perusahaan yaitu memperoleh laba dapat tercapai.
    Dalam rangka memenuhi kebutuhan konsumen dan mencapai tujuan perusahaan, seorang pemimpim harus mengambil suatu kebijakan pemasaran yang tepat agar produk perusahaan dapat dipasarkan terjual semaksimal mungkin.
    Adapun titik tolak untuk membuat kebijkan pemasaran adalah unsur-unsur marketing mix yaitu menyangkut keputusan-keputusan dari empat variabel sebagai berikut menurut philip khotler (2005;20)
    a. Keputusan tentang produk.
    b. Keputusan tentang harga.
    c. Keputusantentang promosi.
    d. Keputusan tentang tempat.
    Penjualan dapat tercipta sutu proses pertukaran barang atau jasa antara penjual dengan pembeli. Di dalam perekonomian seseorang yang menjual sesuatu akan mendapatkan imbalan berupa uang. Dengan alat penukaran berupa uang akan lebih mudah memenuhi segala keinginannnya dan penjualan lebih mudah untuk dilakukan.
    Dalam praktek kegiatan penjualan itu dipengaruhi oleh beberapa faktor. Faktor-faktor tersebut adalah :
    1. Faktor Internal
    Faktor internal disini adalah dimana faktor yang terjadi didalam perusahaan yang dapat mempengaruhi kegiatan penjualan diantaranya adalah :
    a. Kondisi dan Kemampuan Penjual
    Transaksi jual beli atau pemindahan hak milik secara komersial atas barang dan jasa itu pada prinsipnya melibatkan dua pihak, yaitu penjual sebagai pihak pertama dan pembeli sebagai pihak kedua. Disini penjual harus dapat meyakinkan kepada pembeli agar dapat berhasil mencapai sasaran penjualan yang diharapkan. Untuk maksud tersebut penjual harus memahami beberapa masalah penting yang sangat berkaitan yaitu :
    • Jenis dan karakteristik barang yang ditawarkan.
    • Harga produk.
    • Syarat penjualan seperti : pembayaran, penghantar, pelayanan purna jual, garansi dan sebagainya.
    Masalah-masalah tersebut biasanya menjadi perhatian pembeli sebelum melakukan pembelian.
    b. Modal dan Promosi
    Akan lebih sulit bagi penjual untuk menjual barangnya apabila barang yang dijual tersebut belum dikenal oleh pembeli atau apabila lokasi pembeli jauh dari tempat penjual. Dalam keadaan seoerti ini, penjual harus memperkenalkan dulu atau membawa barangnya ketempat pembeli. Untuk melaksanakan maksud tersebut diperlukan adanya sarana serta usaha, seperti alat transportasi, tempet peragaan baik didalam perusahaan maupun di luar perusahaan, usaha promosi dan sebagainya. Semua itu hanya dapat ilakukan apabila penjual memiliki sejumlah modal yang diperlukan untuk itu.
    c. Kondisi Organisasi Perusahaan
    Pada perusahaan besar biasanya masalah penjualan ini ditanganioleh bagian tersendiri yang di pegang oleh orang-orng tertentu di bidang penjualan. Lain halnya dengan perusahaan kecil dimana masalah penjualan ditangani juga oleh orang yang juga melakukan fungsi-fungsi lain. Hal ini disebabkan oleh jumlah tenaga kerjanya lebih sedikit, sistem organisasinya lebih sederhana, masalah-masalah yang dihadapi serta sarana yang dimilikinya juga tidak sekompleks perusahaan besar. Biasanya masalah penjualan iniditangani sendiri oleh pimpinan dan tidak diberikan kepada orang lain.
    2. Faktor Eksternal
    Faktor eksternal ini adalah faktor yang berasal dari luar dari masalah perusahaan. Dimana faktor-faktor tersebut adalah :
    • Lingkungan Makro
    Lingkungan makro merupakan kekuatan yang melingkupi dan secara langsung dan secara tidak langsung terhadap perusahaan lingkungan makro disini lebih banyak berhubungan dengan kebijakan pemerintah, dimana kebijakn pemerintah sering terjadi pertentangan antar satu instansi dengan instansi lainnya. Sehingga perusahaan sangat sulit untuk mengambil kebijakan didalam meningkatkan kegiatan penjualan. Sedangkan untuk permasalahan hukum tidak terlalu berpengaruh karena sudah ada prosedur yang ditetapkan oleh pusat.
    • Kondisi Pasar dan Pesaing
    Pasar sebagai kelompok pembeli atau pihak yang menjadi sasaran dalam prnjualan, dapat juga mempengaruhi kegiatan penjualan. Afapun faktor-faktor kondisi pasar yang perlu diperhatikan :
    a. Jenis pasarnya, apakah pasar konsumen, pasar industri, pasar penjual, pasr pemerintah, atau pasar internasional.
    b. Kelompok pembeli atau segmen pasarnya.
    c. Daya belinya.
    d. Frekuensi pembelinya.
    e. Keingina dan kebutuhan.
    Perusahaan dalam hal ini sekedar memiiki kombinasi yang terbaik saja tetapi keempat variabel tersebut harus di koordinir agar perusahaan dapat melaksanakan tugas pemasarannya seefektif mungkin. Berikut ini akan diuraikan secar ringkas masing-masing variabel yaitu :
    a. Produk
    Keputusan mengenai produk ini berkaitan dengan penentuan bentuk penawaran secara fisik, pemberian merk, pembungkus, warna dan bentuk yang lainnya dengan demikian kebijakan produk ini harus dipasarkan pada keinginan dan kemampuan konsumen. Dari segi produk ini menurut Sukanto Rekohadiprojo, segi yang perlu mendapatkan perhatian adalah :
    1. Pengembangan produk baru
    Dengan semakin meningkatnya persaingan, perusahaan hendaknya terikat pada bentuk yang sudah ada, perusahaan harus mencari produk baru yang sesuai dengan perubahan selera konsumen.
    2. Siklus hidup produk
    Dalam siklus hidup produk ini ada berbgai uasaha yang dapat dijalankan. Untuk itu perusahaan harus dapat mengkaji apa yang terjadi pada penjual, sehingga keuntungan perusahaan, arus kas, langganan dan pesaing dalamfase masa pengenalan, pertumbuhan, kedewasaan penurunan produk.
    3. Campuran produk
    Yakni semua garis penutup dan jenisnya yang ditawarkan penjual kepada pembeli dalam hal ini garis produk, pengusaha dapat membuat mahal bila telah diproduksi murah atau produk besar bila telah diproduksi kecil. Jadi dalam hal ini pengisian garis dimaksud untuk memperoleh tambahan keuntungan denganmenambah jenis produk.
    Setiap perusahaan yang menjual suatu produk dan jasa mempunyai tujuanyang sama yaitu keberhasilan dalam mempertahankan kelangsungan hidup perusahaan (survive) mendapatkan laba dan dapat berkembang. Untuk merealisasikan tujuan tersebut adalah dengan meningkatkan omset penjualan perusahaan.
    Untuk mencapai omset penjualan dan dapat mencapai target pasar maka diperlukan strategi penjualan yang tepat dalam memasarkan produk tersebut di pasar.
    Menurut Widyaningtyas. S. (2002;1) di dalam kegiatan penjualan objek oleh pihak penjual dan pihak pembeli adalah sesuatu yang dinamakan dengan produk. Suatu produk dikatakan bermanfaat bila dengan pembelian atau dengan penggunaan produk tersebut, masalah konsumen / pembeli terpecahkan. Jadi pada dasarnya konsumen tidak hanya membeli produk secara fisik. Dengan kata lain konsumen membeli manfaat.
    Menurut kotler (1996;55) kita dapat membagi produk kedalam tiga tingkat yakni inti produk, wujud produk, produk yang di sermpurnakan.
    1. Inti produk
    Inti produk adalah nilai kegunaan atau manfaat yang dapat memenuhi kebutuhan yang tersembunyi di balik setiap produk.
    2. Wujud Produk
    Wujud produk adalah bentuk produk yang secara fisik dapat dilihat atau diraba secara abstrak dapat dinilai atau dirasakan (untuk produk jasa). Ada lima karakter dari wujud produk, kelima karakteristik wujud produk tersebut adalah : ciri / khas, corak, gaya / model, merk dan kemasan.
    3. Produk yang disempurnakan
    Produk yang disempurnakan adalah diversifikasi manfaat atau kegunaan yang ditambahkan pada inti dan wujud produk, sehingga meningkatkan nilai tambah bagi produk.
    Menurut widyaningtyas sistaningrum (2002;15) penjualan produk terdiri dari barang dan jasa, pelayanan dalam penjualan barang dan jasa tersebut merupakan kegiatan yang tidak kalah pentingnya dalam upaya meningkatkan kualitas produk barang dan jasa yang dijual.
    Tujuan dari kegiatan pelayanan tidak lain adalah Customer Satisfaction atau kepuasan. Jadi jika konsumen meras puas dengan produk atau pelayanan penjualan diharapkan konsumen tersebut menjadi pelanggan.
    b. Harga
    Harga barang atau produk merupakan faktor penting yang menentukan keberhasilan penjualan suatu perusahaan yang menjual dengan harga yang lebih murah pasti akan mendapat pelanggan yang lebih banyak. Dalam hal ini produsen harus lebih hati-hati di dalam menghitung biaya untuk menetapkan harga produknya pada saat ada penawaran dari pembeli. Penetapan harga ini bisa didasarkan pada beberapa aspek antara lain :
    1. Biaya
    2. Permintaan, dan
    3. Persaingan.
    c. Promosi
    Faktor lain yang tidakkalah pentingnya untuk meningkatkan pemasaran adalah promosi. Karena perusahaan tidak hanya dapat tinggal diam menunggu konsumen mencari produksinya melainkan harus berusaha mengenalkan produk kepada konsumen baik secara langsung maupun tidak. Untuk itu ada 4 variabel promosi yang dapat dilakukan antara lain :
    1. Priklanan,
    2. Personal selling,
    3. Promosi penjualan,
    4. Publisitas
    d. Tempat
    Dalam rangka melancarkan arus barang dan jasa dari produsen ke konsumen maka faktor yang perlu diperhatikan adalah masalah saluran tempat pendistribusian, cakupan besar, pengelompokkan lokasi dan persediaan transportasi. Saluran distribusi ini disebut juga saluran peragaan atau saluran pemasaran yang umumnya disebut suatu rute atau jalur.
    BAB 111
    METODE PENELITIAN
    3.1 Metode Pengumpulan Data
    Untuk memperoleh data dan informasi tentang masalah yang akan diteliti maka metode yang dipergunakan dalam penelitian ini adalah :
    a. Library Research (study kepustakaan)
    Dalam metode pengumpulan data ini dilakukan dengan cara mempelajari dan mengkaji berbagai topik yang akan diteliti, seperti literatur-literatur melalui perpustakaan, majalah, surat kabar dan laporan-laporan.
    b. Field Research
    Merupakan suatu cara pengumpulan data dan informasi langsung dari sumber dilapangan untuk memperoleh data primer melalui wawancara terhadap pihak-pihak yang dianggap dapat memberikan informasi yang relevan dan dengan cara pengamatan serta observasi secara langsung pada perumahan aston villa jambi.
    • Wawancara
    Dalam hal ini penulis melakukan pengumpulan datadengan melakukan wawancara langsung terhadap pimpinan perusahaandan bagian pemasaran serta pihak-pihak yang berwenang terhadap data yang diproleh.
    • Observasi
    Teknik pengumpulan data yang dilakukan dengan melakukan pengamatan terhadap objek penelitian dalam rangka memperoleh data sekunder yang diperlukan dengan menggunakan observasi langsung.

    3.2 jenis dan Sumber Data
    Adapun jenis data yang dipergunakan dalam penelitian ini adalah sebagai berikut :
    1. Data primer merupakan data yang didapat dari sumber pertama yaitu berdasrkan hasil wawancara dengan pimpinan dan karyawan bagian pemasaran perumahan aston villa jambi.
    2. Data sekrnder merupakan data prime yang telah diolah lebih lanjut. Dat sekunder yangmeliputi :
    a. Jenis produk,
    b. Perkembangan jumlah tenaga kerja perusahaan,
    c. Struktur organisasi perusahaan,
    d. Keadaan karyawan pada perusahaan.
    Sedangkan sumber data yang digunakan dalam penelitian ini berasalkan dari : perumahan aston villa jambi
    3.3 Metode Analisis
    Metode analisi data yang digunakan dalam penelitian ini adalah analisis deskriftif. Menurut Mohd Nasir (1998;29) analisis deskriftif adalah menganalisa terhadap perkembangan data-data yang ada dan mencoba membandingkan dengan konsep dan prinsip-prinsip yang relevan dengan masalah penelitian.
    3.4 Populasi dan Sampel
    Populasi adalah keseluruhan atau himpunan obyek dengan ciri yang sama Target population adalah kepada siapa (about which) kesimpulan akan diberlakukan atau digeneralisasikan Sampel adalah himpunan bagian atau sebagian dari populasi Sample population adalah darimana (from which) sampel diambil.
    Dalam penelitian ini peneliti mengambil populasi yaitu para penghuni rumah toko yang ada di perumahan Aston villa jambi. Dan penentuan sample peneliti menggunakan . AREA SAMPLING yaitu menenentukan area yang akan disampling, yaitu : area perumahan Aston Villa pada daerah lingkungan rumah toko.

    TINJAUAN PUSTAKA
    Google search : Perum Aston Villa Jambi dan PT. Niaga Guna Kencana.
    http://www.slideshare.net/andiazka/metpen-3-sampling
    http://www.slideshare.net/adios22961/probabilitas-sampling
    Kotler, philip. 2005. Manajemen Pemasaran. Jakarta: Indeks
    Andika. 2010. Analisis strategi penjualan. Skripsi fakultas ekonomi. universitas jambi.

    Komentar oleh Novita Kurniawati | Januari 25, 2012 | Balas

  147. BAB I
    PENDAHULUAN
    A. Latar Belakang Permasalahan Penelitian
    Perkembangan teknologi dan industri membawa dampak bagi kehidupan manusia terutama dunia usaha pada saat ini. Di samping itu banyaknya usaha yang bermunculan baik perusahaan kecil maupun besar berdampak pada persaingan yang ketat antar perusahaan baik yang sejenis maupun yang tidak sejenis. Oleh karena itu pemasaran merupakan salah satu kegiatan yang dilakukan dalam menghadapi persaingan, pengembangan usaha dan untuk mendapatkan laba, sehingga perusahaan dapat mengembangkan produknya, menetapkan harga, mengadakan promosi dan mendistribusikan barang dengan efektif.
    Pada umumnya perusahaan mengalami kesulitan dalam memonitor, memahami dan menganalisis perilaku konsumen secara tepat dan benar, mengingat banyaknya faktor yang mempengaruhi perilaku konsumen dan adanya perbedaan perilaku untuk masing-masing individu. Dengan demikian perusahaan dituntut untuk dapat memantau perubahan-perubahan perilaku konsumennya, termasuk perilaku konsumen untuk mendapatkan atau memilih produk.
    Produk kopi bubuk AAA sebagaimana diketahui adalah salah satu produk minuman yang semakin lama semakin banyak digemari masyarakat karena kemudahan dalam hal penyajiannya. Dengan semakin banyaknya minuman yang ada di pasaran berarti memberikan keleluasaan bagi konsumen untuk memilih merk yang sesuai dengan keinginannya. Oleh karena itu perlu bagi perusahaan untuk menganalisis perilaku konsumen kopi bubuk AAA untuk mengetahui pola pembeliannya. Dengan banyaknya merk kopi yang ada di pasaran akan mendorong perusahaan bersaing mendapatkan calon konsumen melalui berbagai strategi yang tepat, misalnya mengubah kemasan, warna, aroma, promosi dan harga. Lebih jauh lagi produsen dalam mendistribusikan produknya ke pasar konsumen berusaha agar produknya dapat diterima sesuai dengan apa yang diinginkan konsumen.
    Keanekaragaman konsumen dalam memenuhi kebutuhan sehari-hari dapat dipengaruhi oleh berbagai faktor baik yang berasal dari diri konsumen maupun luar konsumen. Beberapa faktor yang dapat mempengaruhi perilaku konsumen diantaranya adalah faktor budaya, sosial, pribadi dan psikologis.Dari uraian tersebut di atas maka judul penelitian ini adalah: “Analisis Faktor – Faktor Perilaku Konsumen Terhadap Keputusan Pembelian Kopi Bubuk AAA”
    B. Perumusan Masalah
    Berdasarkan latar belakang permasalahan di atas dapat ditarik perumusan masalah sebagai berikut:
    1. Bagaimana pengaruh faktor budaya, sosial, pribadi dan psikologis terhadap keputusan konsumen untuk membeli produk kopi bubuk AAA ?
    2. Dari faktor Budaya, sosial, pribadi, dan psikologis diatas, faktor mana yang berpengaruh dominan terhadap keputusan untuk membeli produk kopi bubuk AAA ?
    C. Tujuan Penelitian
    Berdasarkan rumusan masalah tersebut maka dapat disusun tujuan dari penelitian ini adalah untuk mengetahui:
    1. Untuk mengetahui dan menganalisis pengaruh perilaku konsumen yang terdiri dari faktor budaya, sosial, pribadi dan psikologis terhadap keputusan untuk membeli produk kopi bubuk AAA.
    2. Untuk mengetahui diantara faktor budaya, sosial, pribadi dan psikologi yang berpengaruh dominan terhadap keputusan konsumen untuk membeli produk kopi bubuk AAA.
    D. Manfaat Penelitian
    1. Bagi perusahaan hasil penelitian ini dapat digunakan sebagai bahan informasi dan masukan bagi pihak perusahaan untuk mengetahui faktor dominan yang menjadi pertimbangan konsumen untuk mengkonsumsi produk yang ditawarkan sehingga pihak perusahaan akan dapat senantiasa menyusun strategi dalam rangka memenuhi harapan konsumen.
    2. Bagi penulis, selain sebagai syarat menyelesaikan pendidikan, juga dapat menambah khasanah ilmu pengetahuan bidang ilmu manajemen pemasaran, dan melatih penulis untuk dapat menerapkan teori-teori yang diperoleh dari perkuliahan.
    3. Bagi universitas, hasil penelitian ini dapat digunakan sebagai bahan perbandingan dan referensi untuk penelitian selanjutnya.

    BAB II
    METODE PENELITIAN
    A. Obyek / Populasi Penelitian
    Dalam penulisan skripsi ini peneliti menjadikan perusahaan kopi bubuk NEFO sebagai obyek penelitian. Sedangkan subyek / populasi dari penelitian ini adalah konsumen pengguna kopi bubuk AAA.

    B. Variabel Penelitian
    Variabel dalam penelitian ini terbagi atas variabel dependen dan variabel independen. Variabel dependen dari penelitian ini adalah perilaku konsumen ( X ). Sedangkan variabel independennya adalah keputusan pembelian ( Y ).

    C. Jenis Data
    Data yang digunakan dalam penelitian ini adalah data primer. Karena data langsung didapatkan dari responden.

    D. Metode Pengumpulan Data
    Dalam penelitian ini, peneliti menggunakan kuisioner sebagai alat pengumpulan data yang diberikan secara langsung kepada responden.

    E. Tekhnik Pengambilan Sampel
    Sampel adalah sebagian dari populasi yang diteliti. Teknik sampling dalam penelitian ini adalah metode convenience sampling (sampling kemudahan) yaitu pengambilan sampel dari elemen populasi yang datanya mudah diperoleh oleh peneliti (Soehardi, S 1999). Dari penjelasan diatas dapat diketahui bahwa peneliti dapat memilih sampel dengan cepat. Yangmana jumlah sampel yang diambil adalah 120 responden yang dianggap mampu mewakili populasi dari penelitian ini.

    Komentar oleh Nasrudin | Januari 25, 2012 | Balas

  148. Nama : Nasrudin
    NIM : c1b008104

    judul : Analisis faktor – faktor perilaku konsumen terhadap keputusan pembelian kopi bubuk AAA

    BAB I
    PENDAHULUAN
    A. Latar Belakang Permasalahan Penelitian
    Perkembangan teknologi dan industri membawa dampak bagi kehidupan manusia terutama dunia usaha pada saat ini. Di samping itu banyaknya usaha yang bermunculan baik perusahaan kecil maupun besar berdampak pada persaingan yang ketat antar perusahaan baik yang sejenis maupun yang tidak sejenis. Oleh karena itu pemasaran merupakan salah satu kegiatan yang dilakukan dalam menghadapi persaingan, pengembangan usaha dan untuk mendapatkan laba, sehingga perusahaan dapat mengembangkan produknya, menetapkan harga, mengadakan promosi dan mendistribusikan barang dengan efektif.
    Pada umumnya perusahaan mengalami kesulitan dalam memonitor, memahami dan menganalisis perilaku konsumen secara tepat dan benar, mengingat banyaknya faktor yang mempengaruhi perilaku konsumen dan adanya perbedaan perilaku untuk masing-masing individu. Dengan demikian perusahaan dituntut untuk dapat memantau perubahan-perubahan perilaku konsumennya, termasuk perilaku konsumen untuk mendapatkan atau memilih produk.
    Produk kopi bubuk AAA sebagaimana diketahui adalah salah satu produk minuman yang semakin lama semakin banyak digemari masyarakat karena kemudahan dalam hal penyajiannya. Dengan semakin banyaknya minuman yang ada di pasaran berarti memberikan keleluasaan bagi konsumen untuk memilih merk yang sesuai dengan keinginannya. Oleh karena itu perlu bagi perusahaan untuk menganalisis perilaku konsumen kopi bubuk AAA untuk mengetahui pola pembeliannya. Dengan banyaknya merk kopi yang ada di pasaran akan mendorong perusahaan bersaing mendapatkan calon konsumen melalui berbagai strategi yang tepat, misalnya mengubah kemasan, warna, aroma, promosi dan harga. Lebih jauh lagi produsen dalam mendistribusikan produknya ke pasar konsumen berusaha agar produknya dapat diterima sesuai dengan apa yang diinginkan konsumen.
    Keanekaragaman konsumen dalam memenuhi kebutuhan sehari-hari dapat dipengaruhi oleh berbagai faktor baik yang berasal dari diri konsumen maupun luar konsumen. Beberapa faktor yang dapat mempengaruhi perilaku konsumen diantaranya adalah faktor budaya, sosial, pribadi dan psikologis.Dari uraian tersebut di atas maka judul penelitian ini adalah: “Analisis Faktor – Faktor Perilaku Konsumen Terhadap Keputusan Pembelian Kopi Bubuk AAA”
    B. Perumusan Masalah
    Berdasarkan latar belakang permasalahan di atas dapat ditarik perumusan masalah sebagai berikut:
    1. Bagaimana pengaruh faktor budaya, sosial, pribadi dan psikologis terhadap keputusan konsumen untuk membeli produk kopi bubuk AAA ?
    2. Dari faktor Budaya, sosial, pribadi, dan psikologis diatas, faktor mana yang berpengaruh dominan terhadap keputusan untuk membeli produk kopi bubuk AAA ?
    C. Tujuan Penelitian
    Berdasarkan rumusan masalah tersebut maka dapat disusun tujuan dari penelitian ini adalah untuk mengetahui:
    1. Untuk mengetahui dan menganalisis pengaruh perilaku konsumen yang terdiri dari faktor budaya, sosial, pribadi dan psikologis terhadap keputusan untuk membeli produk kopi bubuk AAA.
    2. Untuk mengetahui diantara faktor budaya, sosial, pribadi dan psikologi yang berpengaruh dominan terhadap keputusan konsumen untuk membeli produk kopi bubuk AAA.
    D. Manfaat Penelitian
    1. Bagi perusahaan hasil penelitian ini dapat digunakan sebagai bahan informasi dan masukan bagi pihak perusahaan untuk mengetahui faktor dominan yang menjadi pertimbangan konsumen untuk mengkonsumsi produk yang ditawarkan sehingga pihak perusahaan akan dapat senantiasa menyusun strategi dalam rangka memenuhi harapan konsumen.
    2. Bagi penulis, selain sebagai syarat menyelesaikan pendidikan, juga dapat menambah khasanah ilmu pengetahuan bidang ilmu manajemen pemasaran, dan melatih penulis untuk dapat menerapkan teori-teori yang diperoleh dari perkuliahan.
    3. Bagi universitas, hasil penelitian ini dapat digunakan sebagai bahan perbandingan dan referensi untuk penelitian selanjutnya.

    BAB II
    METODE PENELITIAN
    A. Obyek / Populasi Penelitian
    Dalam penulisan skripsi ini peneliti menjadikan perusahaan kopi bubuk NEFO sebagai obyek penelitian. Sedangkan subyek / populasi dari penelitian ini adalah konsumen pengguna kopi bubuk AAA.

    B. Variabel Penelitian
    Variabel dalam penelitian ini terbagi atas variabel dependen dan variabel independen. Variabel dependen dari penelitian ini adalah perilaku konsumen ( X ). Sedangkan variabel independennya adalah keputusan pembelian ( Y ).

    C. Jenis Data
    Data yang digunakan dalam penelitian ini adalah data primer. Karena data langsung didapatkan dari responden.

    D. Metode Pengumpulan Data
    Dalam penelitian ini, peneliti menggunakan kuisioner sebagai alat pengumpulan data yang diberikan secara langsung kepada responden.

    E. Tekhnik Pengambilan Sampel
    Sampel adalah sebagian dari populasi yang diteliti. Teknik sampling dalam penelitian ini adalah metode convenience sampling (sampling kemudahan) yaitu pengambilan sampel dari elemen populasi yang datanya mudah diperoleh oleh peneliti (Soehardi, S 1999). Dari penjelasan diatas dapat diketahui bahwa peneliti dapat memilih sampel dengan cepat. Yangmana jumlah sampel yang diambil adalah 120 responden yang dianggap mampu mewakili populasi dari penelitian ini.

    Komentar oleh Nasrudin | Januari 25, 2012 | Balas

  149. Nama : Remmy Dodo Jandelli
    NIM : ERC1B009070
    JUDUL : ANALISA STRATEGI PENGGUNAAN “LADY YAKULT” SEBAGAI TENAGA PENJUAL DI PT. YAKULT INDONESIA PERSADA JAMBI

    BAB I
    PENDAHULUAN

    1.1 Latar Belakang Masalah
    Pada umumnya tujuan pokok yang ingin dicapai oleh perusahaan adalah untuk dapat menghasilkan laba, mengalami perkembangan dan menjaga kelangsungan hidup perusahaan. Dengan semakin berkembangnya dunia usaha maka semakin tajam pula tingkat persaingan antara sesama perusahaan. Martono dan Harjito (2001:2), mengatakan bahwa perusahaan memiliki tiga tujuan utama yang saling berkaitan, yaitu mencapai atau memperoleh laba maksimal untuk kemakmuran pemilik perusahaan, menjaga kelangsungan hidup perusahaan (going concern), mencapai kesejahteraan masyarakat sebagai tanggung jawab sosial perusahaan.
    Untuk meraih tujuan tersebut, perusahaan dapat menempuh jalur pemasaran. Salah satu strategi pemasaran yang dapat digunakan adalah sistem direct selling yang dapat mendistribusikan produk langsung ke tangan konsumen. Kekuatan dari sistem direct selling adalah tradisi kemandirian layanan ke konsumen dan komitmen untuk pertumbuhan kewirausahaan dalam sistem pasar bebas. Sistem direct selling menawarkan peluang usaha kepada mereka yang mencari alternatif untuk mendapatkan penghasilan tanpa melihat suku, jenis kelamin, tingkat pendidikan, umur maupun pengalaman. Sistem ini menawarkan peluang untuk mendapatkan penghasilan dengan bekerja paruh waktu maupun penuh waktu. Dalam banyak kasus, peluang direct selling ini berkembang menjadi suatu ‘karir’ yang memuaskan bagi mereka yang mencapai kesuksesan dan memilih untuk bekerja secara full time. Metode direct selling mempunyai kelebihan antara lain, operasinya lebih fleksibel karena penjual dapat mengamati reaksi pelanggan dan menyesuaikan pendekatannya, usaha yang sia-sia dapat diminimalkan, pelanggan yang berminat biasanya langsung membeli, dan penjual dapat membina hubungan jangka panjang dengan pelanggannya. Di dalamnya terkandung praktik salesmanship, negotiating, dan relationship marketing, yang sangat dibutuhkan di era persaingan pasar bebas. Selain itu, keuntungan lain dari sistem ini yaitu penjual dapat menikmati kebebasan waktu, kebebasan dalam menentukan keuntungan, memperoleh pelatihan gratis dari perusahaan/sponsor, dan memperbolehkan orang berbisnis dengan produk atau jasa yang unik dan inovatif, membawa mereka ke pasar tanpa mengeluarkan biaya iklan dan media massa yang sangat besar, dan tanpa harus bersaing di toko-toko pengecer.
    Di sisi pelanggan, biasanya penjual akan mendatangi langsung si calon pelanggan, sehingga mereka tidak perlu repot-repot keluar rumah. Mereka akan mendapatkan penjelasan akan produk sejelas-jelasnya, dan mereka juga bisa langsung menanyakan ketidakjelasannya ketika penjual sedang mempresentasikan produk yang dijualnya.
    Meskipun demikian, sistem direct selling juga menghadapi masalah-masalah seperti orang yang terganggu karena penjualan yang agresif, timbulnya citra buruk bagi industri bila ada salah satu penjual yang menipu pelanggannya, mengganggu privacy orang lain, dan kadangkala ada beberapa penjual yang memanfaatkan atau mengeksploitasi pembeli impulsif atau pembeli yang kurang mengerti teknologi. Selain itu, terdapat beberapa faktor lain yang menyebabkan kegagalan direct selling, antara lain manajemen yang buruk karena kurangnya pengalaman serta komitmen yang diperlukan, kurangnya komunikasi secara efektif dengan para distributor, serta kegagalan memotivasi para distributor. Produk-produk yang dijual mutunya rendah atau pasarnya terbatas. Uraian diatas memperlihatkan bahwa penggunaan sistem direct selling merupakan salah satu hal yang sangat penting peranannya dalam meningkatkan penjualan dan memperkuat posisi perusahaan di tengah–tengah persaingan serta mendorong perkembangan perusahaan, karena untuk mendorong perkembangan perusahaan, perusahaan harus mampu melakukan inovasi–inovasi baru terhadap produknya sehingga konsumen tidak bosan.
    PT. Yakult Indonesia Persada menggunakan strategi pemasaran yang dinamakan dengan sistem direct selling yang mendistribusikan produk secara langsung ke tangan konsumen. Sistem direct selling dalam PT. Yakult Indonesia Persada dinamakan dengan sistem Yakult Lady. Melalui sistem ini, Yakult didistribusikan oleh ibu-ibu rumah tangga kepada masyarakat di lingkungan tempat tinggal mereka. Ketika melayani masyarakat, Yakult Lady juga melakukan propaganda yang berisi tentang penjelasan mengenai manfaat Yakult. Yakult Lady disini merupakan peranan agen yang mendistribusikan langsung produknya ke tangan konsumen. Peranan agen penjualan merupakan salah satu stategi pemasaran yang sangat penting dalam PT. Yakult Indonesia Persada. PT. Yakult Indonesia Persada merupakan usaha patungan dengan status Penanaman Modal Asing (PMA) antara PT. Perkasa Simpati Persada dan Yakult Honsha Co.Ltd. (Jepang). Secara komersial Yakult mulai diproduksi pada tanggal 1 Januari 1991 dari pabrik di Jl. Kiwi Pekayon Pasar Rebo Jakarta. Pada tahun 1997 lokasi pabrik di Pasar Rebo yang kapasitas produksinya 720.000 botol per hari dipindahkan ke Desa Pesawahan, Cicurug, Sukabumi, Jawa Barat dan kapasitas produksi ditingkatkan menjadi 1.800.000 botol per hari. Pada bulan Desember 2001 PT. Yakult Indonesia Persada menjadi PMA murni dengan permodalan dari Yakult Honsha Co. Ltd dan Yakult Management Service Co.Ltd di Jepang.
    Produk minuman kesehatan Yakult sangat sensitif terhadap temperatur. Perubahan temperatur sangat berpengaruh terhadap bakteri Lactobacillus casei yang terdapat dalam minuman Yakult. Bakteri Yakult harus dipertahankan hidup. Karenanya harus diusahakan agar setelah dibotolkan, bakteri-bakteri tersebut tidak lagi melakukan proses fermentasinya. Untuk itu Yakult harus selalu disimpan didalam pendingin (dibawah 10°C) karena penyimpanan didalam pendingin akan menjaga bakteri Yakult tetap non aktif. Berkenaan dengan itu untuk menjaga mutunya, distribusi Yakult ditangani langsung oleh staff perusahaan.
    Melihat bahwa pada kenyataannya sistem direct selling dapat mempertemukan agen-agen penjualan langsung kepada pembeli/pelanggan, dan hal tersebut mempunyai peranan yang penting dalam menciptakan permintaan yang berguna untuk meningkatkan volume penjualan, maka penulis tertarik membahas hal tersebut dalam bentuk skripsi dengan judul: “Peranan Yakult Lady Dalam Upaya Meningkatkan Volume Penjualan Pada PT. Yakult Indonesia Persada Cabang Jambi“.

    1.2 Perumusan Masalah
    Berdasarkan latar belakang yang telah dikemukakan sebelumnya maka penulis merumuskan masalah sebagai berikut: “Apakah peranan yakult lady berpengaruh terhadap peningkatan volume penjualan pada PT. Yakult Indonesia Persada Cabang Jambi?”.

    1.3 Tujuan Penelitian
    Tujuan penelitian ini adalah :
    Untuk mengetahui dan menganalisis bahwa peranan Yakult Lady berpengaruh terhadap peningkatan volume penjualan pada PT. Yakult Indonesia Persada Cabang Jambi.

    1.4 Manfaat Penelitian
    a. Bagi Perusahaan
    Penelitian ini merupakan informasi bagi perusahaan untuk mengetahui keefektifan strategi pemasaran yang dilakukan dalam meningkatkan volume penjualan suatu produk.

    b. Bagi Pihak Lain
    Penelitian ini dapat digunakan sebagai referensi atau sumbangan pemikiran bagi pihak lain terutama bagi mahasiswa yang sedang melakukan penelitian selanjutnya khususnya mengenai peranan agen penjualan dengan volume penjualan.
    c. Bagi Penulis
    Penelitian ini dapat menambah wawasan dan pengetahuan penulis dalam bidang pemasaran terutama dalam memahami seberapa besar peranan agen penjualan dalam meningkatkan volume penjualan.

    BAB II
    METODELOGI PENELITIAN

    2.1 Populasi Penelitian
    Populasi merupakan sekumpulan orang atau objek yang memiliki kesamaan dalam satu atau beberapa hal dan yang membentuk masalah pokok dalam suatu riset khusus baik itu berupa kumpulan orang (individu, kelompok, komunitas, masyarakat, dll); benda (jumlah gedung/bangunan, tempat, dll). Populasi yang diambil dalam penelitiaan ini adalah para Yakult Lady di kota Jambi. Guna memasarkan produk Yakult di dalam dalam Propinsi Jambi.

    2.2 Sample Penelitian
    Bagian dari populasi yang dapat mewakili seluruh populasi atau sebagian unsur populasi yang dijadikan objek penelitian yang disebut dengan sample. Dalam penelitian ini sampel yang diambil adalah sampel representative (Sampel yang memiliki ciri karakteristik yang sama atau relatif sama dengan ciri karakteristik populasinya). Jumlah Populasi Yakult Lady di propinsi Jambi mencapai 51 Orang maka diambil sample untuk wilayah kerja Telanaipura yang hanya berjumlah 1 Orang

    2.3 Jenis dan Sumber Data
    2.3.1 Jenis Data
    Data sekunder merupakan sumber data penelitian yang diperoleh peneliti secara tidak langsung melalui media perantara (diperoleh dan dicatat oleh pihak lain). Data sekunder umumnya berupa bukti, catatan atau laporan historis yang telah tersusun dalam arsip (data dokumenter) yang dipublikasikan dan yang tidak dipublikasikan..
    Data premier adalah sumber data yang diperoleh langsung dari sumber asli (tidak melalui media perantara). Data primer dapat berupa opini subjek (orang) secara individual atau kelompok, hasil observasi terhadap suatu benda (fisik), kejadian atau kegiatan, dan hasil pengujian.

    2.3.2 Sumber Data
    Data diambil dari PT. Yakult Indonesia Persada cabang Jambi

    2.4 Metode pengumpulan data
    Untuk memperoleh data dalam penelitian ini maka digunakan metod pengumpulan data sekunder sebagai berikut :
    2.4.1. Library Research atau Data Eksternal
    Data eksternal dapat dicari dengan mudah karena biasanya data ini tersimpan di perpustakaan umum, perpustakaan kantor-kantor pemerintah atau swasta dan universitas, biro pusat statistik dan asosiasi perdagangan, dan biasanya sudah dalam bentuk standar yang mudah dibaca, seperti petunjuk penelitian, daftar pustaka, ensiklopedi, kamus, buku indeks, buku data statistik dan buku-buku sejenis lainnya.

    2.4.2 Field Research ( Penelitian Lapangan )
    Ada 2 cara untuk mengumpulkan data pada penelitian lapangan yaitu :
    2.4.2.1 Metode observasi
    Metode Observasi adalah peroses pencatatan pola perilaku subyek (orang), objek (benda) atau kejadian yang sistematik tanpa adanya pertanyaan atau komunikasi dengan individu-individu yang diteliti. Baik secara hidden atau visible observation

    2.4.2.2 Metode Interview ( Wawancara )
    Wawancara merupakan teknik pengumpulan data dalam metode survei yang menggunakan pertanyaan secara lisan kepada responden atau subjek penelitian. Yaitu Sumber dari PT. Yakult Indonesia persada baik melalui tatap muka atau melalui telepon.

    DAFTAR PUSTAKA
    http://www.yakult.co.id/index.html
    http://taufiek.wordpress.com/2007/05/10/wisata-propaganda-yakult/
    http://jehanamelia.blogspot.com/2011/02/perjalanan-ke-perusahaan-yakult.htm/
    http://nagabiru86.wordpress.com/2009/06/12/data-sekunder-dan-data-primer/
    http://erikarianto.wordpress.com/2008/01/29/pengertian-direct-selling/

    Komentar oleh Remmy Dodo Jandelli | Januari 25, 2012 | Balas

  150. Tugas 1 (INDIVIDU)
    NAMA : RAHMATULLAH
    NIM : ERCIB009063
    Kelas Ekstensi Sore
    Judul : “Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan Im3 Pada PT. INDOSAT Cabang JAMBI”.

    BAB I
    PENDAHULUAN

    1.1. Latar Belakang

    Seiring dengan perkembangan perekonomian di negara Indonesia saat ini, juga pengaruh dari perkembangan teknologi yang menyebabkan perusahaan dalam perkembangannya dituntut untuk lebih kreatif dan inovatif, sehingga membuat semakin ketatnya persaingan dalam dunia bisnis, dengan semakin ketatnya tingkat persaingan maka dibutuhkan pula fungsi pemasaran yang baik, sehingga tujuan yang di harapkan oleh perusahaan akan tercapai, karena pemasaran perupakan pilar utama yang penting dalam kelangsungan hidup perusahaan.
    Perusahan yang unggul adalah mereka yang dengan tangkas menyiasati perubahan bisnis dan dapat memanfatkan peluang-peluang yang ada, serta mereka yang berhasil memberikan kepuasan bagi pelanggannya, tentunya dengan sesuatu hal yang efektif dan efisien, salah satunya melalui komunikasi secara baik bagi pelanggannya, sehingga hubungan antara produsen atau perusahan dengan pelanggannya akan semakin erat dan harmonis.
    Perusahaan membutuhkan komunikasi dengan pelanggannya yaitu dengan cara melakukan promosi, semakin gencar perusahaan melakukan promosi maka akan semakin dekat di benak pelanggannya. Oleh karena itu banyak perusahan yang berani mengeluarkan anggaran yang cukup besar untuk biaya promosi. Media atau alat promosi yang sering dilakukan perusahaan antara lain melalui: periklanan, Penjualan Personal, Pemasaran Langsung, Hubungan Masyarakat, dan Promosi Penjualan, Alat alat promosi tersebut dapat digunakan sesuai dengan kebutuhan dan kemampuan dari perusahaan itu sendiri.
    Berdasarkan uraian di atas, maka penulis tertarik untuk mengadakan penelitian tentang masalah promosi dalam upaya mempertahankan loyalitas pelanggan pada PT.Indosat Cabang Jambi yang merupakan perusahaan yang bergerak di bidang jasa telekomunikasi, penulis akan mencoba membahas mengenai promosi khususnya produk jasa telekomunikasi yang diterapkan perusahaan dengan judul :
    Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan Im3 Pada PT. INDOSAT Cabang JAMBI”.

    1.2. Rumusan Masalah

    Berdasarkan uraian di atas, maka dapat di Rumuskan masalah-masalah pokok sebagai berikut :
    1.) Apa tujuan pelaksanaan promosi pada PT. Indosat Cabang Jambi
    2.) Bagaimana efektifitas promosi untuk memelihara loyalitas pelanggan Im3 pada PT. Indosat Cabang Jambi
    3.) Faktor faktor yang Mendukung dan menghambat efektifitas promosi untuk memelihara loyalitas pelanggan Im3 pada PT. Indosat Cabang Jambi

    1.3. Tujuan Penelitian

    Adapun tujuan penelitian ini adalah untuk mengetahui:
    1.) Tujuan pelaksanaan promosi pada PT. Indosat Cabang Jambi
    2.) Bagaimana pelaksanaan promosi dalam upaya Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan im3 Pada PT.Indosat Cabang Jambi
    3.) Faktor faktor yang mendukung dan menghambat Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan im3 Pada PT.Indosat Cabang Jambi

    1.4. Manfaat Penelitian

    1.) Bagi perusahaan
    Khususnya bagi PT. Indosat Cabang Jambi, hasil penelitian ini diharapkan dapat memberikan sumbangsih pemikiran dan bahan pertimbangan atau masukan dalam memperbaiki serta meningkatkan pelaksanaan promosi yang dilakukan oleh perusahaan dalam Efektifitas Promosi Untuk Memelihara Loyalitas Pelanggan im3 Pada PT.Indosat Cabang Jambi.
    2.) Bagi penulis
    Hasil penelitian diharapkan dapat menambah wawasan dan pengetahuan secara teoritis maupun secara praktis juga pengalaman mengenai promosi.
    3.) Bagi pihak lain
    Hasil penelitian ini diharapkan dapat memberikan sumbangan pemikiran yang berarti pada semua pihak, khususnya rekan-rekan mahasiswa dalam melaksanakan penelitian yang berhubungan dengan masalah pelaksanaan promosi di masa yang akan datang.

    BAB II
    METODE PENELITIAN

    2.1 Populasi Penelitian
    Populasi adalah keseluruhan subyek/obyek penelitian. Sedangkan sampel adalah sebagian atau wakil populasi yang diteliti. Populasi adalah totalitas dari semua obyek atau individu yang akan diteliti yang mana memiliki karakteristik tertentu, jelas dan lengkap. Populasi dalam penelitian ini adalah masyarakat yang pernah menggunakan atau pelanggan dari produk indosat khususnya kartu Im3 karena besar populasi tidak dapat diketahui secara pasti berapa jumlahnya, oleh karena itu sulit mencari berapa jumlah populasi yang tepat.
    2.2 Sampel Penelitian
    Sampel merupakan bagian dari populasi yang diambil melalui cara-cara tertentu yang juga memiliki karakteristik tertentu, jelas, dan lengkap yang dianggap bisa mewakili populasi. Karena jumlah populasi yang terlalu besar yaitu lebih dari 100 dan keterbatasan waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak 40 responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut pendapat ahli seperti yang dikemukakan oleh Gay (dalam Hasan, 2002:68), “Ukuran sampel minimum yang dapat diterima bisa dilihat berdasarkan pada desain atau metode penelitian yang digunakan, jika desain penelitiannya deskriptif-korelasional, maka sampel minimum adalah 30 responden.
    2.3 Metode Penelitian

    Metode penelitian yang digunakan adalah metode deskriptif, yaitu metode yang berusaha untuk menggambarkan apa yang dilakukan oleh perusahaan berdasarkan fakta yang ada untuk diolah menjadi data. Data tersebut dikumpulkan, dijelaskan dan dianalisis berdasarkan teori yang ada sehingga pada akhirnya menghasilkan kesimpulan.

    2.4 Sumber Data
    Dalam Penulisan Laporan Tugas Akhir ini penulis memperoleh data yang dapat memberikan gambaran sesuai dengan pokok bahasan yang ada. Adapun data yang diperoleh adalah :
    a. Data Primer
    yaitu data yang diperoleh langsung dari responden dengan cara survey langsung ke perusahaan yang bersangkutan serta melakukan observasi dan wawancara.
    b. Data Sekunder
    yaitu data yang diperoleh dengan melakukan studi kepustakaan yang berhubungan dengan masalah yang akan dikaji lebih lanjut.

    2.5 Teknik Pengumpulan Data
    a. Studi Lapangan (Field Research)
    Yaitu teknik pengumpulan data dengan cara melakukan penelitian dan pengamatan secara langsung pada objek yang diteliti.
    Data tersebut penulis peroleh dengan cara :
    b. Wawancara (Interview)
    Yaitu teknik pengumpulan data dengan cara berkomunikasi langsung untuk mendapatkan informasi langsung dari koresponden.
    c. Pengamatan (Observasi)
    Yaitu teknik pengumpulan data dengan cara mengamati langsung data yang berkaitan dengan masalah yang akan diteliti kemudian mencatatnya secara sistematis.
    d. Studi Pustaka (Library Research)
    Yaitu mengumpulkan data sebagai referensi untuk melakukan penelitian dengan mempelajari literatur-literatur yang berhubungan dengan aspek permasalahan dan menunjang pembahasan dalam pembuatan Laporan Tugas Akhir.

    DAFTAR PUSTAKA

    Kotler, Philip. 2000. Manajemen Pemasaran1. Alih Bahasa Hendra Teguh, Ronny A. Rusli dan Benyamin Molan, Edisi Milenium, Prenhallindo : Jakarta.
    Kotler, Philip. Armstrong, Gary. 2001. Prinsip-prinsip Pemasaran I. Alih Bahasa Damos Sihombing, Edisi Kedelapan, Erlangga : Jakarta.
    Kotler, Philip. 2000. Manajemen Pemasaran 2. Alih Bahasa Hendra Teguh, Ronny A. Rusli dan Benyamin Molan, Edisi Milenium, Prenhallindo : Jakarta.
    http://informasi-media.blogspot.com/2007/12/profil-pt-indosat-tbk.html
    http://tatangmanguny.wordpress.com/2009/06/30/sampel-sampling-dan-populasi-penelitian-bagian-ii-teknik-sampling-ii/
    http://www.scribd.com/doc/18003036/Data-Sekunder-Dan-Primer

    Komentar oleh Rahmat | Januari 26, 2012 | Balas

  151. NAMA : SINGGIH PAMBUDI
    NIM : ERC1B009006
    PROPOSAL TENTATIF
    ANALISIS LOYALITAS PELANGGAN INTERNET FLASH UNLIMITED DI KECAMATAN TELANAIPURA KOTA JAMBI

    BAB I

    PENDAHULUAN

    1.1 Latar belakang masalah

    Pertumbuhan akses internet saat ini sangat pesat. Diawali dengan masuknya internet sekitar tahun 1994, saat ini pemakain internet di indonesia sudah mencapai 16 juta, meningkat 8 kali lipat dari hanya sekitar 2 juta ditahun 2000. dari data pertumbuhan tersebut menunjukan bahwa internet di indonesia berkembang pesat. Karena belakangan ini internet dirasakan memiliki berbagai manfaat berarti bagi umat manusia,terutama bagi beberapa golongan yang sangat memperhatikan perkembangan teknologi.
    Secara umum manfaat yang dapat diperoleh apabila seseorang mempunyai akses ke internet adalah memperoleh informasi yang luas tanpa batas secara individu sosial, maupun informasi bisnis/pekerja pun dapat diperoleh melalui akses internet. Akses informasi internet tidak mengenal batas geografis,ras,suku,budaya,negara maupun kelas ekonomi,atau faktor-faktor lain yang biasanya dapat menghambat pertukaran pikiran dari aktifitas tanpa batas ini internet mampu menciptakan suatu komunitas-komunitas unik seperti Friendster,Facebook,Twitter. Dan tidak menutup kemungkinan melalui komunitas dalam internet tersebut dapat terjalin kerja sama bisnis. Karena banyaknya manfaat tersebut maka dewasa ini pengguna internet semakin meningkat jumlahnya seiring dengan banyaknya kemudahan-kemudahan yang diperoleh dalam penggunaan internet. Karena ada kebutuhan dan permintaan yang terus meningkat setiap tahunya,terutama untuk jasa internet.
    Permintaan jasa akan internet ini semakin marak dan melonjak dari seluruh penjuru nusantara,jasa internet ini dirasakan sebagai bisnis yang potensial dan menghasilkan margin yang menguntungkan bagi perusahaan. Melihat potensi tersebut banyak perusahaan provider telekomunikasi seluler yang mencoba peruntunganya dan terjun ke dalam bisnis jasa internet, antara lain Telkomsel dengan jagoan produknya Flash unlimited,Flash prepaid. Indosat dengan jagoan produknya Broo dan IM2. Telkom dengan andalanya speedy dan telkom-net instan, dll.
    Ke semua provider tersebut berusaha meraih pasar sebesar-besarnya dengan berbagai strategi yang diterapkan. Perang teknologi antar provider pun tidak dapat dihindarkan, karena semua operator tersebut berusaha memberikan layanan yang terbaik kepada setiap pelangganya berusaha mengaplikasikan teknologi yang tercanggih dan mutakhir dalam setiap layanannya (HSDPA,EDGE,3G,GPRS,MMS). Menciptakan suatu akses internet yang cepat,memperluas jangkauan jaringan(Coverage area) sehingga akses internet dapat dilakukan setiap wilayah/daerah,kemudian menawarkan tarif yang semurah mungkin da bersaing dengan kompetitornya.

    Telkomsel Flash Unlimited adalah layanan akses internet nirkable (wireless) kecepatan tinggi melalui laptop ataupun PC (Personal Computer) yang dapat diakses melalui modem datacard, ponsel, maupun router. Layanan ini disediakan oleh Telkomsel untuk seluruh pelanggannya pengguna KartuHALO. Telkomsel Flash menawarkan suatu pengalaman baru dalam melakukan koneksi jaringan internet dengan kecepatan tinggi (hingga 3,2 Mbps) dan lokasi akses yang dapat dilakukan dimana saja dalam jangkauan jaringan HSUPA, HSDPA, 3G, EDGE ataupun GPRS.

    Layanan akses internet milik Telkomsel ini pertama kali diluncurkan pada 06 April 2007, di Jakarta. PT. Telkomsel merupakan salah satu perusahaan provider di Indonesia yang masih menjadi market leader dan memiliki market share terbesar dalam industri seluler GSM (Global System Mobile) pra bayar.
    Dengan diciptakannya suatu layanan internet Flash unlimited dan Flash prepaid, PT.Telkomsel mencoba peruntungan bisnis baru dalam bidang internet. Sebagai pendahulu BTS (Base Transceiver Station) milik PT. Telkomsel lebih banyak tersebar kebeberapa penjuru nusantara,bahkan untuk kenyamanan akses internet konsumenya PT.Telkomsel tidak segan-segan untuk menambah kuantitas terabit per bulanya dan kapasitas jaringan data telkomsel telah dipersiapkan mencapai 6000 terabit,tekhnologi future yang diberikan juga cukup canggih dan up to date dengan adanya kerjasama bundling USB modem dengan telkomsel.

    Perusahaan dituntut mampu menawarkan barang atau jasa dengan mutu atau pelayanan yang diberikan pada konsumen dari waktu ke waktu, karena konsumen yang semakin pandai dan terdidik, menyebabkan keinginan dan kebutuhannya berubah sangat cepat. Perusahaan sudah semestinya berorientasi pada pelanggan, agar dapat memenangkan persaingan. Dengan memberikan kepuasan pada pelanggan akan membangun kesetiaan pelanggan dan akhirnya dapat menciptakan hubungan yang erat antara pelanggan dan perusahaan.
    pelanggan Flash Unlimited yang berhenti berlangganan meningkat tiga kali lipat diatas 100%. Fenomena bisnis yang terjadi saat ini adalah perang tarif antar provider layanan internet yang berlangsung gencar dan sengit. Perang tarif ini dikomunikasikan secara besar–besaran dan terang-terangan di berbagai media masa baik cetak maupun elektronik. Bentuk penawaran ini mempengaruhi pola pemikiran dari para konsumen, terutama mengenai harga yang sangat mempengaruhi pola pikir konsumen. Setiap provider berlomba-lomba memberikan fasilitas dan penawaran terbaik demi kepuasan kepada para pelanggannya. Kepuasan pelanggan sangat tergantung pada kinerja dan harapan pelanggan. Kepuasan adalah tingkat perasaan seseorang setelah membandingkan kinerja atau outcame yang dirasakan dengan harapan-harapan terhadap produk tersebut (Philip Kotler, 1997). Tingkat kepuasan pelanggan merupakan perbedaan daya guna yang dirasakan konsumen (perceived performance atau perceived outcame) dan harapan yang ada.

    Dengan adanya deregulasi kebijakan tarif yang ditetapkan setiap operator, hal tersebut otomatis akan mempengaruhi kesetiaan jumlah pelanggan setiap operatornya. Hal ini merupakan persoalan mendasar bagi pihak perusahaan. Syarat yang harus dipenuhi oleh suatu perusahan agar sukses dalam persaingan adalah berusaha mencapai tujuan untuk menciptakan dan mempertahankan pelanggan. Dengan memahami perilaku konsumen, pihak perusahaan dapat mengetahui faktor–faktor apa saja yang dipertimbangkan pelanggan dalam memilih layanan internet yang ditawarkan berbagai provider telekomunikasi, sehingga dapat menetapkan strategi sesuai dengan keinginan pelanggan.dalam sebuah penelitiannya menunjukkan bahwa perusahaan–perusahaan dapat lebih meningkatkan laba dengan mempertahankan pelanggan yang ada, hal ini dikarenakan lebih mahal mendapat pelanggan yang baru. Perusahaan berupaya memahami perilaku konsumennya dan berusaha mempertahankan pelanggannya, karena loyalitas pelanggan sangat penting bagi kelangsungan hidup perusahaan. Variabel harapan pelanggan diyakini memunyai peranan yang besar dalam menentukan kualitas produk (barang atau jasa) dan kepuasan pelanggan.

    Bagi perusahaan yang berorientasi kepada pelanggan (customer oriented), kepuasan pelanggan menjadi sasaran kiat pemasaran. Pelanggan yang dapat tingkat kepuasan tinggi akan memberi ikatan pada merek produk, bukan hanya preferensi nasional dan akhirnya semua ini membangun loyalitas pelanggan. konsumen yang loyal sangat besar artinya selain menggambarkan besarnya profitabilitas yang diperoleh konsumen yang loyal juga dapat menunjukan citra atau image perusahaan di mata public. dan terciptanya customers relationship adalah hal terbaik yang dimiliki perusahaan Pelanggan yang setia dapat menjadi partner dalam mengembangkan produk baru, karena mereka mempertahankan dan membela bahkan menggunakan pelayanan perusahaan yang ada. Dengan adanya deregulasi kebijakan tarif yang ditetapkan setiap operator, hal tersebut otomatis akan mempengaruhi kesetiaan jumlah pelanggan setiap operatornya.

    Hal ini merupakan persoalan mendasar bagi pihak perusahaan. Syarat yang harus dipenuhi oleh suatu perusahan agar sukses dalam persaingan adalah berusaha mencapai tujuan untuk menciptakan dan mempertahankan pelanggan. Dengan memahami perilaku konsumen, pihak perusahaan dapat mengetahui faktor–faktor apa saja yang dipertimbangkan pelanggan dalam memilih layanan internet yang ditawarkan berbagai provider telekomunikasi, sehingga dapat menetapkan strategi sesuai dengan keinginan pelanggan.dalam sebuah penelitiannya menunjukkan bahwa perusahaan–perusahaan dapat lebih meningkatkan laba dengan mempertahankan pelanggan yang ada, hal ini dikarenakan lebih mahal mendapat pelanggan yang baru.

    Perusahaan berupaya memahami perilaku konsumennya dan berusaha mempertahankan pelanggannya, karena loyalitas pelanggan sangat penting bagi kelangsungan hidup perusahaan. mengevaluasinya, pelanggan akan menggunakan harapannya sebagai standard atau acuan pelanggan dalam memilih suatu produk (barang maupun jasa).
    Variabel kualitas produk adalah variabel pembanding antara produk yang diharapkan dengan produk yang diterima konsumen. Variabel kepuasan adalah variabel yang menjelaskan respon konsumen terhadap evaluasi diskrepansi atau ketidaksesuaian yang dirasakan antara harapan sebelumnya dengan kinerja sesungguhnya dari produk yang telah dikonsumsi. Pada penelitian yang akan dilakukan saat ini akan meneliti loyalitas konsumen pengguna layanan internet Flash Unlimited. Adapun beberapa variabel yang diambil adalah harapan pelanggan, kualitas produk, kepuasan pelanggan dan berpengruh terhadap loyalitas. Judul yang diambil dalam penelitian ini adalah “ ANALISIS LOYALITAS PELANGGAN INTERNET FLASH UNLIMITED DI KECAMATAN TELANAIPURA KOTA JAMBI

    1.2 Perumusan masalah

    Loyalitas pelanggan menjadi masalah yang sangat penting karena dapat menjadi indikator keberhasilan perusahaan dalam mencapai keuntungan optimal. Pelanggan yang sudah loyal terhadap suatu produk, selain dapat menghaslkan keuntungan bagi perusahaan juga dapat menutupi kerugian–kerugian yang timbul dari pelanggan yang kurang loyal.

    Persaingan yang semakin ketat dalam bisnis telekomunikasi menuntut perusahaan selaku penyedia jasa telekomunikasi harus mampu memberikan suatu layanan yang berkualitas kepada pelanggannya. Dengan memberikan pelayanan yang berkualitas, sehingga dapat memenuhi atau bahkan melebihi harapan konsumen, akan memberikan kepuasan bagi pengguna Flash Unlimited tersebut.
    Berdasarkan uraian di atas maka dapat ditarik sebuah masalah penelitian mengenai faktor apa saja yang mempengaruhi tingkat keloyalitasan konsumen yang menggunakan layanan internet Flash Unlimited.
    Maka pertanyaan penelitian dapat dirumuskan sebagai berikut :
    • Bagaimana variabel harapan pelanggan berpengaruh terhadap loyalitas pelanggan pengguna layanan internet Flash Unlimited ?
    • Bagaimana variabel kualitas produk berpengaruh terhadap loyalitas pelanggan pengguna layanan internet Flash Unlimited ?
    • Bagaimana variabel kepuasan pelanggan berpengaruh terhadap loyalitas pelanggan pengguna layanan internet Flash Unlimited ?

    1.3 Tujuan Dan Kegunaan Penelitian

    1.3.1 Tujuan Penelitian

    Berdasarkan latar belakang masalah dan rumusan masalah, maka tujuan dari penelitian ini adalah :
    • Menganalisis pengaruh faktor harapan pelanggan terhadap loyalitas konsumen
    • Menganalisis pengaruh faktor kualitas produk terhadap loyalitas konsumen.
    • Menganalisis pengaruh faktor kepuasan konsumen terhadap loyalitas konsumen.

    1.3.2 manfaat penelitian

    Hasil penelitian ini diharapkan memberikan manfaat bagi yang terkait, yaitu :

    1. Bagi Perusahaan

    Bermanfaat sebagai bahan masukan dan tambahan informasi yang dapat dipertimbangkan oleh perusahaan sehingga dapat digunakan dalam menentukan kebijakan.

    2. Bagi Universitas

    Merupakan tambahan informasi dan sebagai bahan referensi perpustakaan bagi para peneliti selanjutnya di Fakultas Ekonomi Universitas jambi.

    BAB III METODE PENELITIAN
    A. Obyek / Populasi Penelitian
    Populasi dan Sampel Menurut Djarwanto (1993) populasi adalah jumlah dari keseluruhan obyek (satuan-satuan dalam individu-individu) yang karakteristiknya hendak diduga. Sedangkan menurut Hadi (1997) populasi adalah sejumlah individu yang mempunyai sifat atau kepentingan yang sama. Dalam penelitian ini populasi yang dimaksud adalah individu yang pernah menggunakan layanan internet Flash Unlimited dari Telkomsel. Dalam penulisan proposal ini yang menjadi obyek penelitian adalah PT. Telkomsel Jambi. Sedangkan subyek/populasi dari penelitian ini adalah masyarakat pengguna flash unlimited di kecamatan Telanaipura jambi
    B.Teknik Pengambilan Sampel
    Sampel adalah sebagian dari populasi yang karakteristiknya hendak diselidiki, dan dianggap dapat mewakili keseluruhan dari populasi (Djarwanto, 1993). Sedangkan Hadi (1997) mendefinisikan bahwa sampel adalah sejumlah individu yang jumlahnya kurang dari populasi. Penelitian ini mengambil sampel konsumen yang sedang menggunakan dan atau pernah menggunakan layanan internet Telkomsel Flash Unlimited.. sasaran dari penelitian ini adalah orang-orang yang telah menggunakan produk flash unlimited di kecamatan Telanaipura Jambi.

    C.Jenis Data

    Data Sekunder, Data sekunder adalah data yang diperoleh secara tidak langsung, baik berupa keterangan maupun literatur yang ada hubungannya dengan penelitian yang sifatnya melengkapi atau mendukung data primer (Hadi, 1997). Dalam penelitian ini data sekunder berupa data pengguna Flash Unlimited di kecamatan telanaipura kota jambi pada periode 2012

    D. Metoda Pengumpulan Data

    Dalam suatu penelitian ilmiah, metode pengumpulan data dimaksudkan untuk memperoleh bahan-bahan yang relevan, akurat, dan, terpercaya. Teknik pengumpulan data pada penelitian ini adalah :
    Kuesioner Metode pengumpulan data yang dilakukan dengan cara memberikan pertanyaan-pertanyaan kepada responden dengan panduan kuesioner. Dalam penelitian ini menggunakan kuesioner dengan pertanyaan tertutup

    A. Variabel Terikat (dependent variable)

    Loyalitas Pelanggan (Y) reaksi atau akibat dari terciptanya kepuasan pelanggan sebagai implementasi dari keberhasilan pelayanan yang berkualitas dalam memenuhi harapan pelanggan. Dari definisi tersebut maka indikator empiris dari variabel Loyalitas Pelanggan menurut Yuda Wicaksana (2008), yaitu :
    1. Pelanggan yang melakukan pembelian ulang secara teratur.
    2. Pelanggan yang membeli produk yang lain di tempat yang sama.
    3. Pelanggan yang mereferensikan kepada orang lain.
    4. Pelanggan yang tidak dapat dipengaruhi pesaing untuk pindah

    B. Variabel Bebas (independent variable)
    1. Harapan Pelanggan (X1)
    Menurut Olson dan Dover (Zeithaml, 1993), harapan pelanggan merupakan keyakinan pelanggan sebelum mencoba atau membeli suatu produk, yang dijadikan standar atau acuan dalam menilai kinerja produk tersebut. Dari definisi tersebut maka indikator empiris dari variabel harapan pelanggan menurut Sri Mulyani (2003), yaitu :
    a) Personal Need / kebutuhan pribadi.
    b) Explicit Services Promises / janji pelayanan secara eksplisit.
    c) Impisit Service Promises / janji pelayanan secara implisit.
    d) Pengalaman masa lampau.

    DAFTAR PUSTAKA

    Kotler, Philip, 1997, Marketing, Jilid 1, Erlangga, Jakarta.
    Marketing, Jilid 2, Erlangga, Jakarta. Kotler, Philip dan Gary Armstrong, 1996, Dasar-dasar Pemasaran, Jilid 1, Erlangga, Jakarta.

    Komentar oleh SINGGIH PAMBUDI | Januari 27, 2012 | Balas

  152. TUGAS SEMESTER
    Nama :Stella Andelina
    Nim :ERC1B009017
    Judul :”Presepsi masyarakat terhadap atribut tupperware di kota jambi ”
    BAB I
    PENDAHULUAN

    A. LATAR BELAKANG
    Kegiatan pemasaran adalah kegiatan penawaran suatu produk atau jasa sesuai dengan kebutuhan dan keinginan konsumen. Kegiatan ini tentu saja tidak terlepas dari keputusan konsumen mengenai salah satu atribut yang dimiliki produk tersebut yaitu harga serta manfaat dari produk itu sendiri . Harga adalah jumlah yang harus diberikan oleh pelanggan terhadap kepemilikan suatu produk atau jasa.
    Perkembangan di sektor dunia usaha tidak menutup kemungkinan menimbulkan persaingan yang semakin ketat di antara perusahaan-perusahaan yang homogen dalam memenangkan pangsa pasar. Untuk itu pengelola perusahaan dituntut agar lebih peka terhadap keinginan konsumen dan pandai-pandai memilih alternatif strategi yang tepat serta mampu memberikan nilai-nilai tambah terhadap produk yang ditawarkan, sehingga perusahaan dapat mengatasi persaingan. Pada persaingan dunia usaha yang ketat ini, selain periklanan, promosi penjualan, sistem Multi Level Marketing juga mempunyai peran yang sangat penting yaitu untuk konsumen akan merasa lebih dekat dengan pemasar atau distributor.
    Pada setiap usaha, baik itu perusahaan yang baru berdiri, yang sedang berkembang maupun yang sudah mapan, kondisi perekonomian yang labil, menjadi faktor penentu bagi perkembangan perusahaan, maka tidak dapat dihindari apa yang dinamakan persaingan dalam mempertahankan dan merebut bagian pasar, setiap perusahaan mempunyai kewajiban untuk menyusun strategi agar perusahaannya mampu bertahan dalam kancah bisnis.Selain salah satu cara ini adalah dilakukannya Multi Level Marketing.
    Perusahaan melakukan pemasaran dengan sistem Multi Level Marketing seperti produk Tupperware (alat-alat rumah tangga) tuppeware Tupperware telah menjadi salah satu perusahaan terkemuka di dunia di bidang wadah plastik untuk penyimpanan maupun penyajian yang berkualitas tinggi dalam usianya yang lebih dari setengah abad. Saat ini Tupperware telah dipasarkan hampir di seratus negara di dunia dan merupakan perusahaan ketiga terbesar di dunia untuk kategori penjualan langsung (Direct Selling). Di Indonesia sendiri, Tupperware mulai dijual sejak tahun 1991.
    Indonesia telah memiliki lebih dari 70 distributor resmi yang tersebar di beberapa kota di Indonesia. punya keunggulan tersendiri yaitu Tupperware dibuat dari bahan bermutu tinggi yang diproses secara cermat dengan garansi seumur hidup. Artinya tupperware akan mengganti produk yang rusak atau cacat dalam pemakaian normal bukan pemakaian komersial. Seandainya produk yang sama tidak tersedia maka akan diganti dengan produk tupperware lain senilai harganya dengan barang tersebut
    Tupperware terbuat dari bahan plastic terbaik, tidak mengandung zat kimia beracun namun juga ramah bagi lingkungan karena produk tupperware bisa didaur ulang. Tupperware telah sukses lebih dari 70 tahun dengan filosofi yang sangat sederhana, kita percaya bahwa yang menjadi dasar untuk sukses tergantung pada :
    1. People (Orang)
    2. Product (Produk)
    3. Plan (Rencana)
    Tupperware banyak diminati oleh ibu rumah tangga karena atribut produk tupperware (harga relatif mahal ,anti basi, ringan ,tahan panas) ,serta bentuknya yang banyak disukai karena modis .tetapi yang menjadi persoalan harganya yang relatif mahal karena sebagian besar pandangan ibu rumah tangga menganggap produk tuppeware hanya mengandalkan brand yang sudah mendunia seperti kalangan menengah ke atas yang banyak menggunakan produk tuppeware karena harganya yang relatif mahal untuk sebuah wadah plastik.Selain itu brand produk rumah tangga lainnya sekarang mulai banyak menyaingi produk tupperware .tetapi atribut produk tupperware mempengaruhi konsumen dalam pembelian karena terkenal dengan wadah anti basi dan anti panas serta di dukung oleh garansi seumur hidup .
    Dan melihat latar belakang diatas hal itulah yang menarik bagi penulis untuk meneliti secara mendalam bagaimana presepsi masyarakat terhadap atribut produk tupperware karena disini penulis ingin menganalisa presepsi masyarakat terhadap atribut tuppewarre(anti basi,tahan panas,modis ringan) di kota Jambi .

    B. Perumusan Masalah
    Berdasarkan latar belakang masalah yang telah dikemukakan di atas, maka penulis merumuskan masalah sebagai berikut:
    1. Apakah atribut produk tupperware mempengaruhi kepada kepuasan konsumen ?
    2. Apakah ekuitas merek (brand equity) seperti asosiasi merek (brand association), persepsi kualitas (perceived quality), dan loyalitas merek (brand loyalty) yang dimiliki Tupperware berpengaruh terhadap kepuasan konsumen ?
    3. Apakah persepsi pada katalog berpengaruh dalam pembelian produk tupperware ?
    4. Apakah sikap terhadap merek berpengaruh pada minat beli ?

    C. Tujuan Masalah
    Tujuan penelitian ini adalah untuk :
    a. Untuk mengetahui dan menganalisis pengaruh atribut Tupperware terhadap keputusan konsumen dalam membeli produk Tupperware.
    b. Untuk meengetahui dan menganalisis variabel ekuitas merek (brand equity) seperti asosiasi merek (brand association), persepsi kualitas (perceived quality), dan loyalitas merek (brand loyalty) yang dimiliki Tupperware berpengaruh terhadap kepuasan konsumen.

    D. Manfaat Penelitian
    Manfaat penelitian ini adalah:
    a. Bagi Penulis:
    Penelitian ini menjadi sarana untuk mengaplikasikan pengetahuan teoritis pemasaran khususnya mengenai atribut produk Tupperware terhadap kepuasan konsumen dalam pembelian produk tupperware.
    b. Bagi Perusahaan:
    Dapat digunakan sebagai salah satu dasar pertimbangan dalam mengelola dan mempertahankan merek agar tetap menjadi pilihan pelanggan mengingat persaingan antar merek yang semakin meningkat.
    c. Bagi Pihak Lain
    Hasil penelitian ini diharapkan dapat digunakan oleh pihak-pihak yang membutuhkan sebagai bahan pertimbangan, perbandingan dan penyempurnaan bagi penelitian selanjutnya.

    E. METODE PENELITIAN
    1. Lokasi Penelitian
    Penelitian ini dilakukan di kelurahan murni kecamatan Telanaipura.
    2. Populasi
    ”Populasi adalah wilayah generalisasi yang terdiri atas obyek atau subyek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulannya” (Sugiyono, 2008:115). Berdasarkan hasil angket yang di sebarkan kepada 10 0rang sampel ibu-ibu rumah tangga yang menggunakan produk tupperware.
    3. Sampel
    ”Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh populasi tersebut” (Sugiyono, 2008:116). Teknik pengambilan sampel dilakukan dengan menggunakan metode purposive sampling, yaitu teknik pengambilan sampel dengan pertimbangan tertentu, yaitu dengan kriteria bahwa ibu-ibu rumah tangga yang dijadikan sampel penelitian adalah ibu-ibu yang telah melakukan pembelian berulang terhadap Tupperware minimal dua kali.

    4. Jenis Pengumpulan Data

    4.1 Jenis Data
    Jenis data dalam penelitian ini berupa :
    – Data Kualitatif, yaitu data yang berbentuk kata, kalimat, , seperti teori-teori yang berkaitan dengan penelitian penulis.
    – Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan (scoring).

    4.2. Sumber Data
    Sumber data dalam penelitian ini berupa :
    Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.

    4.3 Teknik Pengumpulan Data
    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    Kuesioner adalah pengumpulan data dengan cara mengajukan pertanyaan melalui daftar pertanyaan untuk diisi oleh ibu-ibu yang terpilih sebagai responden.

    4.4 Variabel penelitian
    Variabel yang akan digunakan dalam penelitian ini adalah:
    a. Variabel dependen adalah variabel yang dipengaruhi atau yang menjadi akibat, karena adanya variabel bebas” (Sugiyono 2008:59). Variabel terikat dari penelitian ini adalah keputusan konsumen dalam pembelian produk tupperware.
    b. Variabel independen adalah variabel yang mempengaruhi atau yang menjadi sebab perubahannya atau timbulnya variabel dependen (terikat)” (Sugiyono 2008:59). Adapun yang menjadi variabel independen dari penelitian ini adalah variabel kesadaran merek (X1), asosiasi merek (X2), persepsi kualitas (X3), loyalitas merek (X4). Variabel terikat pada penelitian ini adalah loyalitas merk produk tupperware ,konsumen yang melakukan pembelian berulang karena kepuasan terhadap atribut .
    Untuk mengetahui hasil tanggapan responden pada kuisoner yang di sebarkan maka digunakan data interval dengan skala 0-10.

    DAFTAR PUSTAKA

    Kotler, Philip dan Keller, Kevin Lane. Manajemen Pemasaran. Jilid 2, Jakarta: PT INDEKS, 2002

    http://www.library.upnvj.ac.id/pdf/2s1hi/206612147/sk206612147.pdf

    http://repository.usu.ac.id/bitstream/123456789/25662/5/Chapter%20I.pdf

    Fandy, Tjiptono, Strategi Pemasaran, Edisi Kedua, Andy Offset, Yogyakarta: Andy Offset, 1997

    Lampiran 1

    DAFTAR PERTANYAAN
    No.Responden : ……….
    Responden yang terhormat,
    Bersama ini saya mohon kesediaan dari Ibu untuk mengisi daftar kuesioner penelitian yang diberikan kepada Ibu.
    Informasi yang Ibu berikan ini hanya semata-mata untuk data penelitian dan merupakan bantuan yang sangat berarti dalam menyelesaikan penelitian skripsi dengan judul “PRESEPSI MASYARAKAT TERHADAP ATRIBUT TUPPEWERE (ANTI BASI ,RINGAN ,ANTI PANAS DAN MODIS )TERHADAP KEPUASAN KONSUMEN DI KOTA JAMBI”.
    . Atas bantuan dan perhatian Ibu saya ucapkan terima kasih.
    Petunjuk Pengisian
    Dibawah ini ada beberapa kelompok pernyataan yang semuanya berkaitan dengan produk Tupperware. Ibu saya harapkan untuk memberikan jawaban penilaian terhadap pernyataan tersebut sesuai dengan pendapat dan pandangan dari Ibu.
    Berilah tanda checklist ( √ ) pada salah satu jawaban penilaian untuk masing- masing pernyataan dibawah ini sesuai dengan kolom yang tersedia.
    Penilaian atas jawaban pernyataan dilakukan berdasarkan skala berikut ini :
    SS = Sangat Setuju
    S = Setuju
    KS = Kurang Setuju
    TS = Tidak Setuju
    STS = Sangat Tidak Setuju

    Identitas Responden
    Nama :
    Pekerjaan :
    Sudah berapa kali anda membeli produk Tupperware ?
    a. 2 kali
    b. lebih dari 2 kali

    1.Ekuitas Merk
    Kesadaran Merk

    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Tupperware merupakan merek wadah plastik yang pertama kali muncul di pikiran ibu
    2. Merek Tupperware sudah terkenal di kalangan masyarakat umum.
    3. Ibu sudah lama mengenal produk wadah plastik Tupperware

    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Produk Tupperware cocok untuk segala jenis makanan dan minuman.
    2. Tupperware memiliki wadah plastik yang anti tumpah,anti basi ,ringan anti panas
    3. Harganya yang terjangkau

    2.Persepsi kualitas

    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Tupperware merupakan wadah plastik yang memiliki mutu dan kualitas yang cukup baik
    2. Produk Tupperware sangat aman serta atribut tupperwere (anti basi,tahan panas ,ringan )
    3. Produk Tupperware memberikan garansi yang benar-benar bermanfaat bagi pemakainya.

    3.Loyalitas merek
    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Ibu selalu menggunakan merek Tupperware sebagai wadah makanan dan minuman.
    2. Ibu selalu beranggapan bahwa produk merek Tupperware adalah yang terbaik.
    3. Ibu selalu merekomendasikan produk merek Tupperware kepada orang lain.

    Komentar oleh STELLA ANDELINA | Januari 27, 2012 | Balas

  153. NAMA : Dedy Sudarmadi
    NIM : ERC1B009057

    salam pak jo…pak ini proposal tentatif saya..
    “persepsi masyarakat tentang produk handpone buatan china”

    BAB I
    PENDAHULUAN

    1.1 LATAR BELAKANG
    Pemasaran merupakan hal terpenting bagi suatu perusahaan, Kegiatannya pun saat ini terlihat mengalami perkembangan yang semakin pesat, hal ini terutama terlihat dalam hal menghadapi tantangan dan peluang yang selalu berubah – ubah dan tentunya belum pernah dialami sebelumnya oleh setiap perusahaan. Hal ini juga dapat disebabkan karena adanya tingkat persaingan
    antar perusahaan yang semakin ketat pula. Dalam hal ini pemasaran merupakan proses pertemuan antara individu dan kelompok dimana masing-masing pihak ingin mendapatkan apa yang mereka butuhkan/inginkan melalui tahap menciptakan, menawarkan, dan pertukaran. Pemasaran dapat juga di pandang sebagai salah satu kegiatan usaha yang sangat penting dalam upaya mendapatkan dan meningkatkan laba serta menjaga kemampuan dan kelangsungan hidup suatu perusahaan.
    Disetiap aktifitas pemasaran terdapat kegiatan dan strategi yang dapat membantu perusahaan dalam menjalankan kegiatan pemasaran, salah satunya adalah bauran pemasaran. Menurut Marius P. Angipora (2000) bauran pemasaran adalah perangkat variabel-variabel pemasaran terkontrol yang digabungkan perusahaan untuk menghasilkan tanggapan yang diinginkan dalam pasar sasaran. Bauran pemasaran tersebut terbagi menjadi 4 komponen P (Product, Price, Promotion dan Place). Penyusunan bauran pemasaran yang baik serta antisipasi terhadap perubahan pasar dapat menjadikan suatu perusahaan dapat memasarkan produk-produknya kepada konsumen.
    Pada dasarnya Konsep pemasaran (marketing concept) menuntut segala aspek keputusan pemasaran didasarkan pada kebutuhan dan keinginan konsumen. Pelanggan / konsumen membeli produk barang dan jasa untuk memuaskan kebutuhan dan keinginan mereka. Jadi saat pembeli melakukan transaksi
    pasar, konsumen memperoleh seperangkat benefit dan kepuasan dari transaksi tersebut. Dalam hal ini, konsumen tidak akan memecah-mecah penawaran pasar menjadi bagian-bagian komponennya.
    Perkembangan zaman yang semakin kompetitif di lingkungan persaingan bisnis sebagai akibat kemajuan teknologi, telah mengubah cara berfikir masyarakat dalam memilih dan memberikan penilaian terhadap suatu produk. Oleh karenanya perusahaan-perusahaan yang ada pun mulai mengubah strategi pemasarannya yang dahulunya berorientasi pada tingkat produksi dan sekarang mulai berorientasi kepada konsumen.
    Dengan perkembangan teknologi yang selalu mengalami perubahan merangsang manusia untuk pemenuhan akan kebutuhan-kebutuhannya yang tentunya berkaitan dengan pemanfaatan teknologi tersebut. Kemajuan teknologi juga dapat dijadikan sebagai tolok ukur yang dapat menjadikan suatu tatanan kehidupan yang baik bagi manusia. Maka tak diragukan lagi, perkembangan teknologi inipun banyak dimanfaatkan disegala bidang kehidupan Salah satu yaitu berkenaan dalam bidang informasi dan komunikasi.
    Adanya pemanfaatan teknologi dalam bidang informasi dan komunikasi saat ini memberikan peluang besar bagi perusahaan penyedia sarana informasi dan komunikasi. Karena kebutuhan akan informasi dan komunikasi sudah menjadi suatu kebutuhan bagi masyarakat saat ini maka perusahaan-perusahaan yang ada pun saling bersaing menyediakan kebutuhan-kebutuhan tersebut
    dengan berbagai macam sarana informasi dan komunikasi yang berkualitas. Salah satunya sarana informasi dan komunikasi yang sangat dibutuhkan / penting saat ini yaitu handphone.
    Handphone (HP) telah menjadi bagian yang tidak terpisahkan dari kehidupan manusia belakangan ini. HP seakan menjadi hal yang wajib untuk dimiliki. Tidak terbatas pada orang-orang daerah perkotaan, tetapi juga sudah merasuk ke daerah pedesaan. Dengan melihat keberadaan handphone saat ini, memang dapat dikatakan bahwa handphone telah menjadi kebutuhan pokok
    bagi manusia, bukan lagi barang mewah ataupun barang sekunder tetapi telah masuk kepada kebutuhan primer. Hal demikian menjadikan banyak perusahaan telekomunikasi berlomba-lomba menyediakan handphone yang sesuai dengan kebutuhan konsumen tersebut.
    Dari sekian banyak produk handphone yang dipasarkan produknya di Indonesia, muncul saat ini produk handphone baru di Indonesia dengan berbagai merek, yaitu handphone dengan label buatan China. Produk handphone buatan China ini mulai membanjiri negeri ini terutama sejak di berlakukannya
    kerjasama ekonomi China-Asean. Ditandatanganinya Persetujuan Kerja Sama CAFTA secara menyeluruh terjadi pada Januari 2010.
    Kehadiran Ponsel asal China ini acap dipandang sebelah mata. Padahal, Negeri Tirai Bambu memasok lebih dari 50% produk ponsel global. Data dari CCID Consulting menyebut bahwa China menjadi eksportir ponsel terbesar di dunia pada 2008, dengan produksi 605 juta unit.. Kehadiran produk baru di pasaran seperti membanjirnya handphone buatan China tersebut di pasaran menuntut adanya suatu strategi pemasaran yang tepat bagi perusahaan pemasar ataupun agen-agen pemasaran. Menurut Tjiptono strategi pemasaran merupakan suatu alat fundamental yang direncanakan untuk mencapai tujuan perusahaan dengan mengembangkan keunggulan bersaing yang digunakan untuk melayani pasar sasaran. Strategi pemasaran ini harus disesuaikan dengan perubahan-perubahan yang terjadi dalam persepsi, keinginan dan kebutuhan konsumen. Sehingga strategi pemasaran tersebut dapat berjalan dengan efektif.
    Keberadaan handphone buatan China tersebar disemua kota yang ada di Indonesia. Menurut Kepala Pusat Informasi dan Humas Kementerian Kominfo Gatot S. Dewabroto, Pemberlakuan pasar bebas China-ASEAN membuka peluang importer untuk semakin banyak mendatangkan ponsel Tiongkok. Berdasarkan data Ditjen Postel, dalam tiga bulan (Desember 2009 hingga awal Maret 2010). tcrdapat 50 jenis ponsel baru yang diajukan importer untuk dipasarkan di Indonesia. Di antara jumlah itu, 70 persen diimpor dari China.
    Salah satu merek handphone buatan china yang cukup di kenal keberadaanya yaitu merek Nexian. Di Kota Jambi. Keberadaan handphone buatan China ini terbilang cukup banyak dengan berbagai typenya, hal ini dapat diketahui dengan tersedianya handphone buatan China tersebut di counter-counter di Kota Jambi. Kemudahan mendapatkan handphone buatan China di counter-counter menandakan indikasi bahwa counter-counter handphone ini merespon akan kehadiran handphone ini. Peluang inipun di manfaatkan pula
    oleh agen-agen pemasar handphone dan asesoris-asesorisnya yang ada di Kota Jambi untuk mensuplay handphone buatan China tersebut. Berikut dapat dilihat data penjualan salah satu merek handphone buatan China yaitu merek Nexian pada CV. Paradishe communication. CV. Paradishe communication merupakan salah satu agen asesoris dan handphone yang ada di Provinsi Jambi.

    Tabel 1.1
    Data penjualan handphone buatan China merek Nexian
    Pada CV. Paradise Communication
    Tahun 2009
    Bulan Jumlah / Unit % Turun / Naik
    Januari 92 0
    Februari 111 20,65 %
    Maret 121 9 %
    April 150 23,97 %
    Mei 163 8,67 %
    Juni 175 7,36 %
    Juli 182 4 %
    Agustus 202 10,99 %
    September 209 3,47 %
    Oktober 212 1,44 %
    November 222 4,72 %
    Desember 234 5,41 %
    Jumlah 2073 99,78 %
    Sumber : Hasil data primer
    Berdasarkan data penjualan diatas, menunjukkan adanya peningkatan penjualan handphone buatan China tersebut. Peningkatan penjualan handphone tersebut yang terlihat sangat tinggi yaitu terjadi Pada bulan Januari hingga Febuari terjadi kenaikan 19 unit dari 92 unit di bulan Januari menjadi 111 unit atau sekitar 20,65 %, bulan April sebesar 29 unit atau 23,97 % serta bulan Agustus 10,99 % atau sebesar 20 unit. Peningkatan ini tak terlepgs dari adanya persepsi konsumen akan produk handphone buatan China merek Nexian.
    Yang pada akhimya dapat menjadikan suatu keputusan pembelian akan produk tersebut.
    Sebagai perbandingan data, berikut data penjualan Handphone buatan China merek Beyond pada Global Ponsel.

    Tabel 1.2
    Data penjualan handphone buatan China merek Beyond
    Pada Global Tahun 2009
    Bulan Jumlah / Unit % Turun / Naik
    Januari 104 0
    Februari 126 21,15 %
    Maret 99 21.42 %
    April 112 13,13 %
    Mei 93 16,96 %
    Juni 121 30,11 %
    Juli 109 9,91 %
    Agustus 128 16,51 %
    September 132 3,03 %
    Oktober 144 9,09 %
    November 133 7,64 %
    Desember 142 6,77 %
    Jumlah 1443 54,86 %
    Sumber : Hasil data primer

    Berdasarkan data penjualan handphone buatan China merek Beyond diatas menunjukkan angka penjualan yang fruktuatif. Peningkatan tertinggi terjadi pada bulan Oktober dengan jumlah penjualan sebesar 144 unit atau sekitar 9,09 % lebih tinggi dari bulan sebelumnya. Sedangkan penjualan terendah
    yaitu sebesar 93 unit yang terjadi pada bulan Mei atau mengalami penurunan 16,96 % dari bulan April. Jumlah total keseluruhan penjualan pada tahun
    2009 yaitu 1443 unit.
    Berdasarkan kedua data penjulan handphone buatan China merek Nexian dan Beyond diatas, menunjukkan handphone buatan China merek Nexian mendapat perhatian lebih dari konsumen, hal ini dapat diketahui dengan tingkat penjualan yang mengalami peningkatan pada tiap bulannya di tahun 2009, sedangkan handphone buatan China merek Beyond menunjukkan tingkat penjualan yang fruktuaktif pada tahun 2009. Meskipun handphone buatan
    China merek Beyond telah hadir lebih dahulu di pasar handphone di banding handphone buatan China merek Nexian yang hadir sebagai pendatang baru di dunia ponsel Indonesia. Hal demikian tentunya tidak terlepas dari berbagai hal yang di tawarkan handphone buatan China merek Nexian terkait dengan
    atribut-atributnya sehingga mampu bersaing dengan produk handphone lama yang telah hadir lebih dahulu.
    Nexian telah mengeluarkan beragam jenis handphone : mulai dari TV Phone, Dual Mode (CDMA-GSM), Dual GSM On hingga Multimedia Phone. Selain mengandalkan kualitas produk, kepuasan pelanggan juga mendapat perhatian intensif dari Nexian Mobile. Nexian memiliki 21 Service Center
    resmi yang tersebar di seluruh Indonesia seperti Medan, Jambi, Bengkulu, Palembang, Pekanbaru, Lampung, Jakarta, Bandung, Tasik, Yogyakarta, Surabaya, Situbondo, Bali, Kupang, Samarinda, Balikpapan, Banjarmasin, Pontianak, Makasar, Palu, dan Menado. Di tengah persaingan yang ketat dan maraknya puluhan handphone lokal, Nexian tetap optimis untuk terus meningkatkan market sharenya di Indonesia.
    Produk handphone buatan china merupakan produk baru dipasaran handphone di Indonesia, kehadiran produk baru mengharuskan adanya komunikasi bisnis yang tepat bagi konsumen. Dengan memberikan informasi-informasi kepada konsumen akan produk handphone ini sehingganya produk handphone ini dapat dikenal dan konsumen dapat memberikan persepsi dengan baik, yang pada diharapkan konsumen dapat mengambil suatu keputusan pembelian handphone ini. Persepsi konsumen menurut Kotler ( 2002 ) merupakan proses yang digunakan seorang individu untuk memilih akhirnya, mengorganisasikan dan menafsirkan masukan-masukan informasi guna menciptakan gambaran dunia yang memiliki arti. Persepsi konsumen terhadap variabel-variabel yang melekat pada handphone buatan China seperti harga, kualitas, desain, merek serta pelayanan dapat mempengaruhi konsumen dalam hal memilih atau pun melakukan keputusan pembelian produk handphone buatan China. artinya persepsi konsumen ini memegang peranan penting sebelum terjadinya pembelian produk handphone tersebut nantinya.
    Berdasarkan uraian-uraian di atas, yaitu keberadaan handphone buatan China sebagai produk baru di pasar handphone Indonesia dan kaitanya dengan bagaimana persepsi konsumen terhadap handphone china tersebut, maka peneliti bermaksud untuk melakukan penelitian akan persepsi konsumen terhadap handphone buatan China berdasarkan atribut yang dimilikinya. Dengan judul : “Analisis Persepsi Konsumen Terhadap Handphone Buatan China

    1.2 PERUMUSAN MASALAH
    Handphone saat ini telah menjadi bagian yang tidak terpisahkan dari kehidupan manusia. Handphone menjadi hal yang wajib untuk dimiliki. Tidak terbatas pada orang-orang didaerah perkotaan, tetapi juga didaerah pedesaan. Dengan melihat keadaan tersebut, dapat dikatakan bahwa handphone telah menjadi suatu kebutuhan pokok bagi manusia, bukan lagi barang mewah ataupun barang sekunder tetapi telah masuk kepada kebutuhan primer.
    Kebutuhan pokok terhadap handphone tersebut menjadikan banyak perusahaan elektronik bidang telekomunikasi berlomba-lomba menciptakan produk handphone. Salah satunya yaitu perusahaan-perusahaan dari China dengan berbagai produk handphonenya atau biasa dikenal dengan handphone buatan China. Handphone – handphone buatan China ini memiliki beragam merek.
    Sebagai pemain baru dalam pasar handphone di Indonesia, handphone buatan china telah mengeluarkan beragam jenis handphone : mulai dari TV Phone, Dual Mode (CDMA-GSM), Dual GSM On hingga Multimedia Phone dengan teknologi terdepan yang dinamis, inovatif dan tentunya berkualitas. Hal demikian dilakukan agar hanphone buatan china mampu bersaing dengan produk handphone lainya yang telah hadir terlebih dahulu di Indonesia.
    Berdasarkan data penjualan handphone china pada label 1.1. menunjukkan adanya apresiasi dari konsumen, hal demikian dapat diketahui dengan adanya peningkatan jumlah penjualan handphone china tersebut. Peningkatan ini tak terlepas dari berbagai atribut yang ditawarkan oleh Handphone china itu sendiri, mulai dari segi harga, kualitas, desain hingga pelayanannya. Peningkatan ini juga tidak terlepas dari adanya persepsi konsumen mengenai produk handphone buatan china, dikarenakan proses persepsi merupakan pemahaman awal konsumen atas masukan informasi akan produk handphone Nexian tersebut, dan pada akhirnya dapat memungkinkan suatu keputusan pembelian terhadap produk handphone buatan China itu sendiri.
    Berdasarkan uraian diatas, memperlihatkan adanya fenomena yang menarik untuk diadakannya suatu penelitian akan handphone buatan China
    tersebut dengan permasalahan yang diteliti yaitu mengenai : “Bagaimana persepsi konsumen terhadap handphone buatan China berdasarkan atribut harga, kualitas, desain, merek serta Pelayanan”

    1.3 TUJUAN DAN MANFAAT

    1.3.1 TUJUAN PENELITIAN
    1. Untuk mengetahui gambaran persepsi konsumen terhadap handphone buatan China berdasarkan atribut harga, kualitas, desain, merek serta pelayanan.
    2. Untuk menganalisis persepsi konsumen terhadap handphone buatan China berdasarkan atribut harga, kualitas, desain, merek serta pelayanan.

    1.3.2 MANFAAT PENELITIAN

    1. Bagi penulis
    Penelitian merupakan kesempatan yang baik untuk menerapkan teori kasusnya di bidang pemasaran ke dalam dunia praktek yang sesungguhnya serta untuk mengembangkan pemikiran mengenai persepsi konsumen terhadap suatu produk.
    2. Bagi perusahaan
    Hasil penelitian ini dapat dijadikan bahan masukan yang bermanfaat bagi perusahaan dalam mengambil keputusan yang berhubungan kegiatan pemasaran handphone buatan China yang sesuai dengan keinginan dan kebutuhan konsumen.
    3. Bagi pihak lain
    Hasil penelitian ini dapat digunakan sebagai bahan referensi bagi pembaca dan dapat memberikan informasi bagi penelitian lain yang berkaitan dengan bidang pemasaran.

    1.4 RUANG LINGKUP PENELITIAN
    Dalam penelitian ini penulis membatasi ruang lingkup yang akan dibahas yaitu pada bidang manajemen pemasaran dan aspek yang diteliti adalah persepsi konsumen terhadap handphone buatan China.

    1.5 DAFTAR PUSTAKA

    jjlifeblog.wordpress.com/.
    roxymarket.com
    http://www.globalmarket.com
    Kotler, Philip, 1997, Marketing,
    http://www.medantalk.com/hp-cina-terjual-150-juta-unit-di-indonesia/
    http://www.hpmurah.info/tag/hp-china/

    terimakasih pak, mohon saranya

    Komentar oleh DEDY SUDARMADI | Januari 27, 2012 | Balas

    • pak ini lanjutan dari propsal saya.. mohon saranya pak

      BAB II
      TINJAUAN PUSTAKA
      Landasan Teori
      1.Pengertian Pemasaran
      Sehubungan dengan permasalahan yang terdapat dalam penelitian ini maka diperlukan adanya teori-teori atau konsep-konsep yang memerlukan penjelasan. Dalam benyak perusahaan dewasa ini, pemasaran memegang peranan sebagai suatu faktor penting untuk tetap bertahan menjalankan usaha dan bergelut dalam dunia persaingan. Pemasaran merupakan factor vital sebagai strategi pesrusahaan dalam menjalankan usahanya, yang terutama berhubungan dengan konsumen. Kata pemasaran sendiri berasal dari kata pasar, atau bias juga diartikan dengan mekanisme yang mempertemukan permintaan dan penawaran.
      Menurut Kotler ( 2002 : 9 ) “Pemasaran adalah proses social yang didalamnyaa individu dan kelompok mendapatkan apa yang meraka butuhkan dan inginkan dengan menciptakan, menawarkan, dan secara bebas mempertukarkan produks yang bernilai dengan pihak lain”.
      Menurut Stanton ( 1996 : 6 ) “Pemasaran adalah suatu system keseluruhan dari kegiatan-kegiatan usaha yang ditujukan untuk merencanakan, menentukan harga, mempromosikan, mendistribusikan barang dan jasa yang dapat memuaskan kebutuhan baik kepada pembeli yang ada meupun pembeli potensial”.
      Menurut Lamb, Hair, Me Daniel ( 2001 : 6 ) “Pemasaran adalah suatu proses perencanaan dan menjalankan konsep, harga, promosi, dan sejumlah ide, barang, dan jasa untuk menciptakan pertukaran yang mampu memuaskan tujuan individu dan organisasi”.
      Dari ketiga definisi diatas dapat ditarik kesimpulan bahwa pada dasarnya pemasaran bukan hanya kegiatan menjual barang maupun jasa tetapi juga meliputi kegiatan untuk memenuhi keinginan dan kebutuhan dengan berusaha mempengaruhi konsumen untuk bersedia membeli barang dan jasa perusahaan melalui penciptaan, penawaran, dan pertukaran produk yang bernilai. Hal ini sangat penting bagi manajer pemasaran untuk memahami tingkah laku konsumen tersebut. Sehingga perusahaan dapat mengembangkan, menentukan harga, mempromosikan, dan mendistribusikan produk secara lebih baik. Dengan mempelajari prilaku konsumen, manajer akan mengetahui kesempatan, mengidentifikasi, serta menentukan segmentasi pasar secara tepat dan akurat.

      2.Prilaku Konsumen
      Menurut Swasta ( 1992 : 9 ) “Prilaku konsumen dapat didefinisikan sebagai kegiatan-kegiatan individu-individu yang secara langsung terlibat dalam memdapatkan termasuk mempergunakan barang-barang dan jasa, keputusan pada persiapan dan penentuan kegiatan-kegiatan tersebut”.
      Menurut Peter J. Paul dan jerry C. Olson ( 2000 : 6 ) “Prilaku konsumen merupakan interaksi dinamis antara pengaruh dan kondisi prilaku dan kejadian di sekitar lingkungan di mana manusia melakukan aspek pertukaran dalam kehidupan mereka”.
      Dari dua jenis definissi di atas dilihat ada dua hal penting dari prilaku konsumen yaitu proses pengembalian keputusan dan kegiatan fisik yang semuanya ini melibatkan individu dalam menilai, mendapatlkan dan mempergunakan barang-barang dan jasa secara ekonomis. Dengan kata lain prilaku konsumen adalah ilmu yang mempelajari tingkah laku konsumen dalam arti tindakan-tindakan yang dilakukan untuk membeli suatu barang atau jasa tertentu.

      3.Faktor-faktor Yang Mempengaruhi Prilaku Pembelian Konsumen
      Menurut Kotler ( 2002 : 183 ) Faktor-faktor yang mempengaruhi prilaku pembelian konsumen yaitu :
      a.Faktor Kebudayaan
      Kebudayaan mempunyai penaruh paling luas dan mendalam terhadap prilaku konsumen. Terdiri dari budaya, sub budaya, dan kelas social. Budaya yang merupakan karakter paling penting dari suatu social yang membedakannya dari kelompok budaya lain menjadi penentu dan keinginan dan prilaku yang paling mendasar. Masing-masing budaya terdiri dari sub budaya yang memberikan lebih banyak ciri-ciri dan sosialisasi.Sub budaya adalah suatu kelompok homogeny atas sejumlah orang yang terbagi menjadi beberapa bagian dari keseluruhan suatu budaya. Masyarakat dalam suatu budaya dan sub budaya sesungguhnya terbagi dalam strata atau kelas social. Kelas social merupakan sekelompok orang yang sama-sama mempertimbangkan secara dekat persamaan diantara mereka sendiri.

      b.Faktor Sosial
      Pada umumnya konsumen sering meminta pendapat dari orang sekitas dan lingkungannya tentang produk apa yang harus dibeli. Karena itulah lingkungan sosial memberikan pengaruh terhadap prilaku konsumen. Faktor Sosial terdiri dari 3 bagian, yaitu : kelompok acuan, keluarga, dan peran. Kelompok acuan adalah semua kelompok yang memilki pengaruh langsung terhadap sikap / prilaku seseorang. Dengan pendapat yang diperoleh dari suatu kelompok maka konsumen dapat membuat keputusan konsumsi. Keluarga sebagai organisasi pembelian konsumen yang paling penting juga berpengaruh secara langsung terhadap keputusan seseorang dalam membeli barang sehari-hari. Sedangkan peran meliputi kegiatan yang diharapkan akan dilakukan seseorang. Suatu produk atau merk dapat menggambarkan peran dan status pamakainya.

      c.Faktor Pribadi
      Mulai dari bayi hingga dewasa dan menjadi tua, manusia selalu membutuhkan barang dan jasa. Pilihan barang yang dibeli secara otomatis dipengaruhi oleh keadaan ekonomi dan gaya hidup yang bersangkutan. Gaya hidup adalah cara hidup seseorang yang terlihat melalui aktivitas sehari-hari, minat dan pendapat seseorang. Seseorang dengan pendapatan yang tinggi dan gaya hidup mewah tentunya akan menentukan pilihan pada barang dan jasa yang berkualitas. Selain itu kepribadian dan konsep diri juga mempengaruhi pilihan produk. Konsep diri adalah bagaimana konsumen mempresepsikan diri mereka sendiri, yang meliputi sikap, persepsi, keyakinan, dan evaluasi diri. Karena sangat berguna dalam menganalisis prilaku sonsumen sehingga banyak perusahaan menggunakan konsep yang berhubungan dengan kepribadian seseorang.

      d.Faktor Psikologis
      Sikap pembelian psikologis dipengaruhi oleh empat facktor psikologis utama, yaitu : motivasi, persepsi, pembelajaran dan kepercayaan. Motivasi merupakan kebutuhan yang mendorong seseorang dalam melakukan sesuatu sesuai dengan tujuan yang ingin dicapai. Melalui motivasi proses pengamatan dan belajar seseorang memperoleh kepercayaan terhadap suatu produk yang secara otomatis mempengaruhi prilaku pembelian konsumen. Para konsumen mengembangkan beberapa kenyakinan mengenai ciri-ciri dari suatu produk dan selanjutnya akan membentuk suatu sikap konsumen terhadap produk tersebut.

      4.Faktor Pribadi
      Menurut Kotler ( 2002 : 204 ) tujuan pemasaran adalah memenuhi dan memuaskan kebutuhan serta keinginan pelanggan yang menjadi sasaran. Pada bidang prilaku konsumen ini mempelajari bagaimana individu, kelompok, dan organisasi memilih, membeli, memakai, dan membuang barang , jasa, gagasan atau pengalaman dalam rangka memuasakan kebutuhan dan hasrat mereka. Para perusahaan yang cermat melakukan riset atau Quesioner atas riset atas proses keputusan pembelian yang ada dalam jenis produk mereka. Ketika membuat keputusan untuk membeli suatu produk, konsumen melewati tahap-tahap sebagai berikut :

      a. Pengenalan Masalah
      Proses pembelian dimulai saat pembeli mengenali sebuah masalah atau kebutuhan. Pembeli merasakan perbedaan antara keadaan aktualnya dengan keadaan yang diinginkannya. Kebutuhan umum seseorang seperti lapar, haus, saat mencapai titik tertentu dapat menjadi sebuah dorongan. Kebutuhan juga dapat ditimbulkan oleh rangsangan eksternal seperti ketika seseorang melihat iklan mobil dan ingin membelinya. Dengan mengumpulkan informasi dari sejumlah konsumen, pemasar dapat menidentifikasi rangsangan yang paling sering membengkitkan minat akan suatu jenis produk. Pemasar kemudian dapat membangkitkan strategi pemasaran yang memicu minat konsumen.

      b.Pencarian Informasi
      Saat seseorang mulai menyadari kebutuhannya, maka pilihan produk dan merk harus diidentifikasi untuk memenuhi kebutuhanya. Dalam mencari berbagai alternative pilihan untuk memuaskan kebutuhan, seorang konsumen dipengaruhi oleh faktor-faktor seperti beberapa banyak biaya waktu, berapa banyak informasi dari masa alalu dan sumber-sumber lain yang sudah dimiliki oleh konsumen. Yang menjadi minat utama pemasar adalah sumber-sumber informasi utama yang menjadi acuan konsumen dan pengaruh relative dari tiap sumber tersebut terhadap kepuasan pembelian selanjutnya. Sewcara umum konsumen mendapatkan informasi tentang suatu produk dari sumber komersial yaitu sumber yang didominasi oleh pemasar.

      c. Evaluasi Alternatif
      Jika samua alternative yang wajar telah diidentifikasikan, konsumen harus mengevaluasinya satu per satu sebagai persiapan untuk mengadakan pembelian. Kriteria evaluasi yang dipakai konsumen mencakup pengalaman masa lalu dan sikap terhadap aneka merk. Konsumen juga mendengarkan tanggapan-tanggapan keluarga dan kelompok lain. Beberapa konsep dasar akan dapat membantu pemasar dalam memahami proses evaluasi konsumen. Pertama, konsumen berusaha memenuhi suatu kebutuhan. Kedua, konsumen mencari manfaat tertentu dari suatu produk. Ketiga, konsumen memandang setiap produk sebagai sekumpulan atribut dengan kemampuan yang berbeda-beda dalam memberikan manfaat yang dicari untuk memuasakan kebutuhan.

      d.Keputusan Pembelian
      Setelah mencari dan mengvaluasi berbagai alternative untuk memenuhi kebutuhan, konsumen pada titik tertentu harus memutuskan antara membeli atau tidak membeli, jika keputusan yang diambil adalah membeli, konsumen harus membuat rangkaian keputusan yang menyangkut merk, harga, tempat penjualan, warna, dan lain-lain.

      KERANGKA FIKIRAN

      Persepsi masyarakat tentang produk handpone buatan china|
      Tanggapan terhadap Pelanggan
      |
      Tingkat Kepuasan Pelanggan terhadap produk handpone buatan china
      Penelitian sebelumnya.

      BAB III
      METODE PENELITIAN

      A.Lokasi Penelitian
      Penelitian ini mengambil lokasi pada counter counter Handpone kota jambi
      B.Populasi dan Sampel
      1.Populasi Penelitian
      Populasi dalam penlitian ini adalah seluruh mayarakat kota jambi yang menggunakan produk handpone buatan china
      2.Sampel Penelitian
      Karena jumlah populasi yang terlalu besar keterbatasan dan,waktu, serta tenaga yang dimiliki, maka jumlah sampel yang akan diambil sebanyak beberapa responden yang terdapat dalam populasi tersebut. Dimana manurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat.

      C.Jenis dan Sumber Data
      1.Jenis Data
      Jenis data dalam penelitian ini berupa :
      a.Data Kualitatif, yaitu data yang berbentuk kata, kalimat, skema, dan gambar, sepertu literature-literatur serta teori-teori yang berkaitan dengan penelitian penulis.
      b.Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan ( scoring ).
      2.Sumber Data
      Sumber data dalam penelitian ini berupa :
      a.Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.
      b.Data Sekunder, yaitu data yng diperoleh dalam bentuk yang sudah jadi, sudah dikumpulkan dan diolah oleh pihak lain. Biasanya sudah dalam bentuk publikasi saperti data yang diperoleh dari situasi-situasi internet dan data lainnya yang berhubungan langsung dengan objek yang diteliti.

      D.Teknik Pengumpulan Data
      Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
      a.Interview, yaitu suatu metode pengumpulan data dengan cara mengadakan wawancara langsung dengan responden dengan bantuan daftar pertanyaan untuk mengumpulkan data primer.
      b.Kuesioner, yaitu suatu teknik pengumpulan data yang dilakukan dengan cara memberikan seperangkat pertanyaan atau pertanyaan tertulis pada responden untuk menjawab.

      E.Variabel penelitian
      Variabel yang akan digunakan dalam penelitian ini adalah :
      1.VAriabel terikat (Y) : Prilaku konsumen dalam pembelian produk handpone buatan china
      2.Variabel bebas (X) : Harga,selera, kualitas, harga jual kembali, prestise dan promosi.
      Untuk mengetahui hasil tanggapan responden terhadap variabel-veriabel
      F.Definisi Operasional Variabel
      1.Harga (X1)
      Melihat tanggapan konsumen mengenai variabel harga harga handpone china yang ditetapkan dibandingkan dengan harga produk pesaingnya yang sejenis.
      X1.1Perbandingan dengan harga pesaing
      Tanggapan konsumen terhadap perbandingan harga handpone buatan china dengan handpone merk lain yang sejenis seperti mito,venera dan lain-lain. Diukur dalam rupiah.
      X1.2Harga yang ditetapkan
      Tanggpan konsumen terhadap harga yang ditetapkan dari produk yang dbeli konsumen. Diukur dalam rupiah.

      Komentar oleh DEDY SUDARMADI | Januari 27, 2012 | Balas

  154. TUGAS SEMESTER
    Nama :Stella Andelina
    Nim :ERC1B009017
    Judul :”Presepsi masyarakat terhadap atribut tupperware di kota jambi ”
    BAB I
    PENDAHULUAN

    A. LATAR BELAKANG
    Kegiatan pemasaran adalah kegiatan penawaran suatu produk atau jasa sesuai dengan kebutuhan dan keinginan konsumen. Kegiatan ini tentu saja tidak terlepas dari keputusan konsumen mengenai salah satu atribut yang dimiliki produk tersebut yaitu harga serta manfaat dari produk itu sendiri . Harga adalah jumlah yang harus diberikan oleh pelanggan terhadap kepemilikan suatu produk atau jasa.
    Perkembangan di sektor dunia usaha tidak menutup kemungkinan menimbulkan persaingan yang semakin ketat di antara perusahaan-perusahaan yang homogen dalam memenangkan pangsa pasar. Untuk itu pengelola perusahaan dituntut agar lebih peka terhadap keinginan konsumen dan pandai-pandai memilih alternatif strategi yang tepat serta mampu memberikan nilai-nilai tambah terhadap produk yang ditawarkan, sehingga perusahaan dapat mengatasi persaingan. Pada persaingan dunia usaha yang ketat ini, selain periklanan, promosi penjualan, sistem Multi Level Marketing juga mempunyai peran yang sangat penting yaitu untuk konsumen akan merasa lebih dekat dengan pemasar atau distributor.
    Pada setiap usaha, baik itu perusahaan yang baru berdiri, yang sedang berkembang maupun yang sudah mapan, kondisi perekonomian yang labil, menjadi faktor penentu bagi perkembangan perusahaan, maka tidak dapat dihindari apa yang dinamakan persaingan dalam mempertahankan dan merebut bagian pasar, setiap perusahaan mempunyai kewajiban untuk menyusun strategi agar perusahaannya mampu bertahan dalam kancah bisnis.Selain salah satu cara ini adalah dilakukannya Multi Level Marketing.
    Perusahaan melakukan pemasaran dengan sistem Multi Level Marketing seperti produk Tupperware (alat-alat rumah tangga) tuppeware Tupperware telah menjadi salah satu perusahaan terkemuka di dunia di bidang wadah plastik untuk penyimpanan maupun penyajian yang berkualitas tinggi dalam usianya yang lebih dari setengah abad. Saat ini Tupperware telah dipasarkan hampir di seratus negara di dunia dan merupakan perusahaan ketiga terbesar di dunia untuk kategori penjualan langsung (Direct Selling). Di Indonesia sendiri, Tupperware mulai dijual sejak tahun 1991.
    Indonesia telah memiliki lebih dari 70 distributor resmi yang tersebar di beberapa kota di Indonesia. punya keunggulan tersendiri yaitu Tupperware dibuat dari bahan bermutu tinggi yang diproses secara cermat dengan garansi seumur hidup. Artinya tupperware akan mengganti produk yang rusak atau cacat dalam pemakaian normal bukan pemakaian komersial. Seandainya produk yang sama tidak tersedia maka akan diganti dengan produk tupperware lain senilai harganya dengan barang tersebut
    Tupperware terbuat dari bahan plastic terbaik, tidak mengandung zat kimia beracun namun juga ramah bagi lingkungan karena produk tupperware bisa didaur ulang. Tupperware telah sukses lebih dari 70 tahun dengan filosofi yang sangat sederhana, kita percaya bahwa yang menjadi dasar untuk sukses tergantung pada :
    1. People (Orang)
    2. Product (Produk)
    3. Plan (Rencana)
    Tupperware banyak diminati oleh ibu rumah tangga karena atribut produk tupperware (harga relatif mahal ,anti basi, ringan ,tahan panas) ,serta bentuknya yang banyak disukai karena modis .tetapi yang menjadi persoalan harganya yang relatif mahal karena sebagian besar pandangan ibu rumah tangga menganggap produk tuppeware hanya mengandalkan brand yang sudah mendunia seperti kalangan menengah ke atas yang banyak menggunakan produk tuppeware karena harganya yang relatif mahal untuk sebuah wadah plastik.Selain itu brand produk rumah tangga lainnya sekarang mulai banyak menyaingi produk tupperware .tetapi atribut produk tupperware mempengaruhi konsumen dalam pembelian karena terkenal dengan wadah anti basi dan anti panas serta di dukung oleh garansi seumur hidup .
    Dan melihat latar belakang diatas hal itulah yang menarik bagi penulis untuk meneliti secara mendalam bagaimana presepsi masyarakat terhadap atribut produk tupperware karena disini penulis ingin menganalisa presepsi masyarakat terhadap atribut tuppewarre(anti basi,tahan panas,modis ringan) di kota Jambi .

    B. Perumusan Masalah
    Berdasarkan latar belakang masalah yang telah dikemukakan di atas, maka penulis merumuskan masalah sebagai berikut:
    1. Apakah atribut produk tupperware mempengaruhi kepada kepuasan konsumen ?
    2. Apakah ekuitas merek (brand equity) seperti asosiasi merek (brand association), persepsi kualitas (perceived quality), dan loyalitas merek (brand loyalty) yang dimiliki Tupperware berpengaruh terhadap kepuasan konsumen ?
    3. Apakah persepsi pada katalog berpengaruh dalam pembelian produk tupperware ?
    4. Apakah sikap terhadap merek berpengaruh pada minat beli ?

    C. Tujuan Masalah
    Tujuan penelitian ini adalah untuk :
    a. Untuk mengetahui dan menganalisis pengaruh atribut Tupperware terhadap keputusan konsumen dalam membeli produk Tupperware.
    b. Untuk meengetahui dan menganalisis variabel ekuitas merek (brand equity) seperti asosiasi merek (brand association), persepsi kualitas (perceived quality), dan loyalitas merek (brand loyalty) yang dimiliki Tupperware berpengaruh terhadap kepuasan konsumen.

    D. Manfaat Penelitian
    Manfaat penelitian ini adalah:
    a. Bagi Penulis:
    Penelitian ini menjadi sarana untuk mengaplikasikan pengetahuan teoritis pemasaran khususnya mengenai atribut produk Tupperware terhadap kepuasan konsumen dalam pembelian produk tupperware.
    b. Bagi Perusahaan:
    Dapat digunakan sebagai salah satu dasar pertimbangan dalam mengelola dan mempertahankan merek agar tetap menjadi pilihan pelanggan mengingat persaingan antar merek yang semakin meningkat.
    c. Bagi Pihak Lain
    Hasil penelitian ini diharapkan dapat digunakan oleh pihak-pihak yang membutuhkan sebagai bahan pertimbangan, perbandingan dan penyempurnaan bagi penelitian selanjutnya.

    E. METODE PENELITIAN
    1. Lokasi Penelitian
    Penelitian ini dilakukan di kelurahan murni kecamatan Telanaipura.
    2. Populasi
    ”Populasi adalah wilayah generalisasi yang terdiri atas obyek atau subyek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulannya” (Sugiyono, 2008:115). Berdasarkan hasil angket yang di sebarkan kepada 10 0rang sampel ibu-ibu rumah tangga yang menggunakan produk tupperware.
    3. Sampel
    ”Sampel adalah bagian dari jumlah dan karakteristik yang dimiliki oleh populasi tersebut” (Sugiyono, 2008:116). Teknik pengambilan sampel dilakukan dengan menggunakan metode purposive sampling, yaitu teknik pengambilan sampel dengan pertimbangan tertentu, yaitu dengan kriteria bahwa ibu-ibu rumah tangga yang dijadikan sampel penelitian adalah ibu-ibu yang telah melakukan pembelian berulang terhadap Tupperware minimal dua kali.

    4. Jenis Pengumpulan Data

    4.1 Jenis Data
    Jenis data dalam penelitian ini berupa :
    – Data Kualitatif, yaitu data yang berbentuk kata, kalimat, , seperti teori-teori yang berkaitan dengan penelitian penulis.
    – Data Kuantitatif, yaitu data yang berbentuk angka atau data kualitatif yang diangkakan (scoring).

    4.2. Sumber Data
    Sumber data dalam penelitian ini berupa :
    Data primer, yaitu data yang diperoleh langsung dari responden penelitian melalui wawancara dan kuesioner di lapangan.

    4.3 Teknik Pengumpulan Data
    Metode pengumpulan data yang dipergunakan pada penelitian ini adalah :
    Kuesioner adalah pengumpulan data dengan cara mengajukan pertanyaan melalui daftar pertanyaan untuk diisi oleh ibu-ibu yang terpilih sebagai responden.

    4.4 Variabel penelitian
    Variabel yang akan digunakan dalam penelitian ini adalah:
    a. Variabel dependen adalah variabel yang dipengaruhi atau yang menjadi akibat, karena adanya variabel bebas” (Sugiyono 2008:59). Variabel terikat dari penelitian ini adalah keputusan konsumen dalam pembelian produk tupperware.
    b. Variabel independen adalah variabel yang mempengaruhi atau yang menjadi sebab perubahannya atau timbulnya variabel dependen (terikat)” (Sugiyono 2008:59). Adapun yang menjadi variabel independen dari penelitian ini adalah variabel kesadaran merek (X1), asosiasi merek (X2), persepsi kualitas (X3), loyalitas merek (X4). Variabel terikat pada penelitian ini adalah loyalitas merk produk tupperware ,konsumen yang melakukan pembelian berulang karena kepuasan terhadap atribut .
    Untuk mengetahui hasil tanggapan responden pada kuisoner yang di sebarkan maka digunakan data interval dengan skala 0-10.

    DAFTAR PUSTAKA

    Kotler, Philip dan Keller, Kevin Lane. Manajemen Pemasaran. Jilid 2, Jakarta: PT INDEKS, 2002

    http://www.library.upnvj.ac.id/pdf/2s1hi/206612147/sk206612147.pdf

    http://repository.usu.ac.id/bitstream/123456789/25662/5/Chapter%20I.pdf

    Fandy, Tjiptono, Strategi Pemasaran, Edisi Kedua, Andy Offset, Yogyakarta: Andy Offset, 1997

    Lampiran 1

    DAFTAR PERTANYAAN
    No.Responden : ……….
    Responden yang terhormat,
    Bersama ini saya mohon kesediaan dari Ibu untuk mengisi daftar kuesioner penelitian yang diberikan kepada Ibu.
    Informasi yang Ibu berikan ini hanya semata-mata untuk data penelitian dan merupakan bantuan yang sangat berarti dalam menyelesaikan penelitian skripsi dengan judul “PRESEPSI MASYARAKAT TERHADAP ATRIBUT TUPPEWERE (ANTI BASI ,RINGAN ,ANTI PANAS DAN MODIS )TERHADAP KEPUASAN KONSUMEN DI KOTA JAMBI”.
    . Atas bantuan dan perhatian Ibu saya ucapkan terima kasih.
    Petunjuk Pengisian
    Dibawah ini ada beberapa kelompok pernyataan yang semuanya berkaitan dengan produk Tupperware. Ibu saya harapkan untuk memberikan jawaban penilaian terhadap pernyataan tersebut sesuai dengan pendapat dan pandangan dari Ibu.
    Berilah tanda checklist ( √ ) pada salah satu jawaban penilaian untuk masing- masing pernyataan dibawah ini sesuai dengan kolom yang tersedia.
    Penilaian atas jawaban pernyataan dilakukan berdasarkan skala berikut ini :
    SS = Sangat Setuju
    S = Setuju
    KS = Kurang Setuju
    TS = Tidak Setuju
    STS = Sangat Tidak Setuju

    Identitas Responden
    Nama :
    Pekerjaan :
    Sudah berapa kali anda membeli produk Tupperware ?
    a. 2 kali
    b. lebih dari 2 kali

    1.Ekuitas Merk
    Kesadaran Merk

    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Tupperware merupakan merek wadah plastik yang pertama kali muncul di pikiran ibu
    2. Merek Tupperware sudah terkenal di kalangan masyarakat umum.
    3. Ibu sudah lama mengenal produk wadah plastik Tupperware

    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Produk Tupperware cocok untuk segala jenis makanan dan minuman.
    2. Tupperware memiliki wadah plastik yang anti tumpah,anti basi ,ringan anti panas
    3. Harganya yang terjangkau

    2.Persepsi kualitas

    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Tupperware merupakan wadah plastik yang memiliki mutu dan kualitas yang cukup baik
    2. Produk Tupperware sangat aman serta atribut tupperwere (anti basi,tahan panas ,ringan )
    3. Produk Tupperware memberikan garansi yang benar-benar bermanfaat bagi pemakainya.

    3.Loyalitas merek
    No Pernyataan STS(sangat tidak setuju) TS(Tidak Setuju) KS(kurang setuju) S(setuju) SS(Sangat Setuju)
    1. Ibu selalu menggunakan merek Tupperware sebagai wadah makanan dan minuman.
    2. Ibu selalu beranggapan bahwa produk merek Tupperware adalah yang terbaik.
    3. Ibu selalu merekomendasikan produk merek Tupperware kepada orang lain.

    Stella judul yg sama sudah dikerjakan kakak kelasmu. Topik ini tetap dapat dilanjutkan dg judul yg berbeda.

    Komentar oleh STELLA ANDELINA | Januari 27, 2012 | Balas

  155. PROPOSAL TENTATIF
    JUDUL PROPOSAL : PENGARUH MODEL IKLAN KOSMETIK PIXY TERHADAP KONSUMEN DALAM PEMBELIAN PRODUK PIXY DI KOTA JAMBI
    NAMA : INDAH INTAN SARI
    NIM : ERC1B009080
    KELAS MANAJEMEN SORE
    BAB I
    PENDAHULUAN
    1.1 Latar Belakang Masalah
    Televisi sebagai salah satu media komunikasi massa memiliki peran besar dalam menyebarkan informasi dan memberikan hiburan ke semua lapisan masyarakat. Perkembangan dunia pertelevisian di Indonesia menunjukkan perkembangan yang luar biasa. Perkembangan seperti itu tidak dapat dilepaskan dari dukungan berbagai iklan yang telah ditayangkan . Saat ini banyak televisi swasta yang bermunculan, jadi sudah dapat dipastikan juga jumlah iklan yang beredar pun terus meningkat. Media televisi memiliki kekuatan informasi persuasi yang lebih sempurna karena televisi mampu menimbulkan pengaruh yang kuat dengan menekankan pada dua indera sekaligus, yaitu pendengaran dan penglihatan sehingga efek yang ditimbulkan lebih dahsyat baik yang positif maupun negatif.
    Perpaduan antara kata-kata dan gambar mampu ditayangkan di televisi, jadi tepat apabila media televisi dipilih sebagai sarana peyampaian iklan. Informasi mengenai barang atau jasa dapat dengan mudah diketahui secara langsung melalui iklan yang ditayangkan di televisi, terutama produk-produk baru maupun produk yang diandalkan. Sebagaimana pendapat Susan P. Douglas and C. Samuel Craig (2006:5) bahwa “Much advertising is designed to promote and introduce new products from one society into another. Often this results in radical change in life-styles,behavior patterns of a society, stimulating for example the adoption of fast food,casual attire or hygiene and beauty products”.
    Di zaman modern seperti sekarang ini, iklan memang bukan barang baru lagi dalam pertelevisian di Indonesia. Iklan telah beranjak dari posisinya yang hanya “jualan” menjadi bagian dari tontonan. Dengan durasi yang hanya beberapa saat, kini iklan bagaikan sebuah drama pendek dengan berbagai tema romantis, komedi, bahkan horor. Salah satu tayangan yang mendominasi layar kaca adalah iklan-iklan produk kosmetik untuk wanita. Tidak terhitung banyaknya iklan yang mengangkat tema seputar tubuh wanita, mulai dari iklan shampoo, iklan deodorant, hand and body lotion hingga perawatan untuk kulit wajah wanita.
    Tayangan-tayangan iklan yang menarik menjadikan pikiran masyarakat tertuju pada produk yg telah disampaikan. Lalu berapa banyak iklan yang dapat menarik perhatian audiens setelah mengetahui isi pesan dari iklan yang ditayangkan tersebut. Iklan memiliki pengaruh yang sangat luar biasa terhadap audiens. Iklan adalah alat paling jitu untuk memperkenalkan sebuah produk pada konsumen. Yang sebelumnya tidak tertarik serta tidak mengetahui jadi tertarik akibat pengetahuan akan iklan tersebut. Upaya untuk meningkatkan konsumsi secara massal melalui publikasi media massa dalam bentuk iklan. Iklan yang ditayangkan dalam televisi bertujuan untuk mengenalkan suatu produk baru pada masyarakat luas baik produk dalam negeri maupun luar negeri.
    Periklanan banyak dirancang untuk mempromosikan dan memperkenalkan produk-produk baru dari satu masyarakat ke masyarakat yang lain. Seringkali hal ini malah menyebabkan perubahan radikal dalam gaya hidup, pola perilaku masyarakat, merangsang pemikiran seseorang terhadap sesuatu misalnya adopsi makanan cepat saji, pakaian kasual, kesehatan dan bahkan produk kecantikan.
    Jika kita meluangkan waktu mengamati iklan-iklan yang selalu muncul atau saat menyelingi acara di televisi, sebagian besar diantaranya hampir dipastikan berisi iklan produk perawatan kecantikan untuk wanita. Produsen kosmetika sering menggunakan motif yang terdapat dalam diri wanita untuk mengiklankan produknya seperti dikatakan oleh Jalaluddin Rakhmat (1994: 298) bahwa pesan-pesan kita dimaksudkan untuk mempengaruhi orang lain maka kita harus menyentuh motif yang menggerakkan atau mendorong perilaku komunikate. Oleh karena itu, iklan kosmetik (sebuah produk kecantikan perawatan kulit wajah)
    misalnya, iklan pemutih wajah selalu menampilkan model cantik, menarik, dan populer sehingga bisa menambah kepercayaan akan produk, yang pada akhirnya mampu “memaksa” khalayak sasaran untuk membeli produk yang diiklankan tersebut.
    Keberhasilan sebuah iklan produk kecantikan wanita juga tak lepas dari keterlibatan model yang tampil untuk menawarkan produk tersebut. Biasanya suatu produk lebih cepat dikenal jika yang menjadi model iklan adalah figur orang terkenal , seperti seorang model yang berparas cantik, seorang bintang film, penyanyi, artis sinetron dan sebagainya. Tugas seorang model dalam hal ini adalah ia harus bisa mengkomunikasikan produk yang akan ditawarkan agar lebih terasa berbeda dengan produk serupa dan membuat iklan menjadi semenarik mungkin agar menarik minat konsumen terhadap produk yang ditawarkan. Ekspresi model dalam hal ini juga sangat berpengaruh sehingga pesan yang disampaikan oleh pihak pemasar dapat sampai kepada segmen yang dituju.
    Contohnya salah satu produk kecantikan PIXY UV Whitening yang diproduksi untuk memutihkan kulit wajah menjadikan Nabila Syakieb sebagai model di dalam penayangan iklannya di televisi. Pada iklan tersebut diceritakan bahwa kulit wajah Nabil Syakieb jauh lebih putih dan halus setelah memakai produk kecantikan perawatan kulit wajah PIXY UV Whitening. Secara visual, iklan ini sangat menarik sebab tokoh wanita yang digambarkan merupakan representasi wanita cantik. Salah satu teknik para pembuat iklan agar produk yang dipasarkannya bisa laku adalah dengan menjadikan perempuan-perempuan cantik seperti Nabila Syakieb dalam iklan produk kecantikan PIXY UV Whitening sebagai ikon produknya. . Dengan memanfaatkan psikologi kaum perempuan yang selalu menganggap diri dan tubuhnya tidak sempurna maka kesempurnaan tubuh seorang perempuan dalam iklan produk kecantikan dan perawatan kulit wajah dicitrakan dan diidealisasikan sebagai sosok seorang perempuan yang jauh berbeda dengan sebagian besar perempuan. Karena sebagian besar perempuan tidak seperti para model di berbagai iklan perawatan kulit wajah yang ditayangkan di televisi. Mereka (kaum perempuan) akan berlomba-lomba membeli produk perawatan kecantikan tersebut agar dirinya bisa seperti model-model yang dijanjikan dalam sebuah tayangan iklan produk kecantikan wajah di televisi.
    Penggunaan istilah opinion leader juga cukup efektif dalam membangun perasaan yang sama dengan konsumen. Manusia akan cenderung meniru apa yang dilakukan oleh orang yang dianggap lebih darinya. Misalnya dalam hal penggunaan kosmetik, konsumen dalam hal ini wanita akan cenderung meniru tokoh yang diidolakan dalam hal kecantikan seperti artis sinetron atau model yang berwajah cantik. Maka disaat seperti ini seorang pemasar harus jeli dalam menentukan siapa tokoh yang akan dijadikan sebagai modelnya nanti agar bisa mempengaruhi konsumen lebih jauh lagi untuk membeli produk kecantikan yang ditawarkan. Renald Kasali (1995: 79) berpendapat bahwa ada beragam cara untuk mendekati khalayak sasaran agar menarik perhatian mereka, mulai dari menampilkan paras sang model yang cantik dan sensual hingga kata-kata manis dan cerdik dan penuh siasat serta menjanjikan penampilan seperti yang diinginkan oleh kaum wanita. Tiada hari tanpa iklan, begitulah gambaran karena terlalu banyak iklan yang muncul di televisi. Beragam iklan selalu tampil atau pada saat menyelingi rangkaian acara di televisi. Hal tersebut sudah pasti mampu merebut hati pemirsa yang sebelumnya tidak tertarik pada sebuah produk, namun karena iklan yang ditayangkan begitu gencarnya sehingga lama kelamaan tertarik dan ingin mencobanya.

    1.2 Rumusan Masalah
    Berdasarkan latar belakang masalah yang telah dikemukakan diatas dapat dirumuskan masalah sebagai berikut:
    Apakah Model iklan kosmetik pixy mempengaruhi keputusan pembelian konsumen terhadap produk pixy di kota Jambi?
    Jika model iklan kosmetik Pixy mempengaruhi keputusan pembelian, Apa pengaruh daya tarik dari model iklan kosmetik Pixy tersebut?
    Apakah kredibilitas model iklan kosmetik Pixy juga berpengaruh terhadap keputusan pembelian produk Pixy di kota Jambi?

    1.3 Tujuan penelitian
    Berdasarkan latar belakang dan perumusan masalah yang telah ditentukan maka tujuan dari penelitian ini adalah :
    1. Untuk mengetahui pengaruh dari model iklan kosmetik pixy terhadap keputusan konsumen dalam pembelian produk Pixy di Kota Jambi
    2. Dengan dilakukan nya penelitian ini peneliti diharapkan bisa menganalisa faktor – faktor apa saja yang bisa mempengaruhi keputusan pembelian terhadap suatu produk yang dalam penelitian ini objek nya adalah kosmetik Pixy.

    1.4 Manfaat Penelitian
    Adapun manfaat dari penelitian ini adalah sebagai berikut:
    1. Bagi perusahaan, pemasar dan model kosmetik Pixy
    Dengan adanya penelitian ini diharapkan akan ada pertimbangan dan informasi bagi perusahaan, pemasar dan model iklan kosmetik pixy untuk lebih meningkatkan kualitas produk Pixy baik dari segi kualitas produknya, Model yang memerankan produk hingga iklan produk Pixy yang ditayangkan agar lebih inovativ dan inspiratif lagi.
    2. Bagi peneliti
    Sebagai salah satu syarat untuk mendapatkan nilai pada mata kuliah Metode Penelitian (MEP). Penelitian ini juga membantu peneliti untuk menerapakn teori – teori yang pernah di pelajari tentang faktor – faktor yang mempengaruhi keputusan konsumen dalam pembelian suatu produk
    3. Bagi Universitas
    Sebagai tambahan referensi bagi para akademis yang ingin lebih memahami tentang faktor – faktor yang mempengaruhi konsumen dalam pengambilan keputusan pembelian suatu produk.

    BAB II
    METODE PENELITIAN
    2.1 Populasi
    Populasi adalah wilayah generalisasi yang terdiri atas : objek/subjek yang mempunyai kualitas dan karakteristik tertentu yang ditetapkan oleh peneliti untuk dipelajari dan kemudian ditarik kesimpulannya. Populasi bukan hanya orang, tetapi juga objek dan benda-benda alam yang lain. Populasi juga bukan sekedar jumlah yang ada pada objek/subjek yang dipelajari, tetapi meliputi seluruh karateristik/ sifat yang dimiliiki subjek/objek tersebut (Sugiono, 2010, hal 115). Populasi yang diambil pada penelitian ini adalah para wanita baik remaja maupun wanita dewasa dengan rentang usia 18 – 35 tahun yang menggunakan produk Pixy.
    2.1 Sampel Penelitian
    Sample adalah suatu bagian dari populasi yang akan di teliti yang di anggap dapat menggambarkan populasi (soerhatono 2004). Didalam penelitian ini terdapat lebih dari 100 responden, karena jumlah populasinya yang terlalu besar dan keterbatasan waktu, serta tenaga yang dimiliki, maka say putuskan jumlah sampel yang akan diambil sebanyak 50 responden saja. Menurut Arikunto ( 2002 : 112 ) jika populasi lebih dari 100 orang maka diambil sampai 5%-10% atau 20%-30% dari jumlah populasi. Sedangkan menurut Guildford ( 1987 : 125 ) jumlah sampel yang diambil adalah lebih besar dari persyaratan minimal sebanyak 30 responden dimana semakin besar sampel akan memberikan hasil yang lebih akurat

    2.3 Jenis dan Sumber Data
    2.3.1 Jenis Data
    Data Primer
    Data yang di peroleh langsung dari responden penelitian melalui wawancara dan kuesioner dilapangan.
    Data Sekunder
    Data yang diperoleh dalam bentuk data yang sudah jadi, sudah dikumpulkan dan sudah diolah oleh pihak lain serta sudah dipublikasikan di internet.
    2.3.2 Sumber Data
    Sumber data berasal dari responden langsung dilapangan dan berasal dari pencarian data di internet.

    2.4 Metode Pengumpulan Data
    Metode pengumpulan data yang di gunakan dalam penelitian ini adalah :
    2.4.1 Library Reseacrh (penelitian ke perpustakaan)
    Penelitian yang dilakukan dengan mempelajari literatur-literatur, buku-buku dan penelitian lainnya yang ada hubungannya dengan masalah yang diteliti.
    2.4.2 Field Research (penelitian lapangan)
    Penelitian yang dilakukan dengan cara langsung turun kelapangan guna memperoleh data dan informasi dari responden yang menggunakan produk Pixy melalui tehnik sebagai berikut:
    a. Metode observasi, dalam metode ini dilakukan pengamatan langsung dengan meninjau dan mengamati hal-hal yang reverensi terhadap objek penelitian
    b. Metode interview, pada metode ini dilakukan tehnik wawancara langsung pada responden yang menggunakan produk Pix

    2.5 Daftar Pustaka
    Kotler, Philip.2002.Manajemen Pemasaran (terjemahan).Edisis Millenium, jilid 1.PT. Prenhallindo : Jakarta.
    Engel, F. James, Roger D. Blackwell dan Paul W. Miniard. 1992. Perilaku Konsumen Jilid 1 (Edisi Keenam). Binarupa Akasara : Jakarta
    http://parapenuliskreatif.wordpress.com/2010/03/24/pengaruh-iklan-produk-kosmetik-di-televisi-terhadap-perilaku-wanita/
    http://verawati-pr.blogspot.com/2010/01/pengaruh-tayangan-iklan-produk-kosmetik.html
    http://jmpf.farmasi.ugm.ac.id/artikel-103-pengaruh-kredibilitas-dan-daya-tarik-endorser-lokal-dan-asing–dalam-iklan-kosmetik-terhadap-persepsi-dan-keputusan–pembelian-konsumen.html

    Judul boleh dilanjuti, tapi ingat judul yg sama untuk produk yg berbeda telah dilakkan oleh kakak kelasmu baik di pagi maupun di sore. Silahkan tulis apa bedanya yg anda buat dg yg dibuat temanmu.

    Komentar oleh INDAH INTAN SARI | Januari 27, 2012 | Balas

  156. NAMA : WAHYU AFERO
    NIM : ERC1B 009013
    PROPOSAL TENTATIF
    JUDUL : “PENGARUH CITRA TOKO TERHADAP MINAT BELI KONSUMEN PADA MINI MARKET TRI D MART”
    BAB I
    PENDAHULUAN
    1.1 latar belakang
    Potensi pasar Indonesia yang cukup besar serta meningkatnya usaha kelas kecil dan menengah telah menambah besarnya jumlah kelompok masyarakat berpenghasilan menengah atas. meningkatnya jumlah kelompok masyarakat ini ternyata berpengaruh terhadap perilaku dan gaya hidup masyarakat tersebut dalam kehidupan sehari-hari yang menganut gaya hidup yang modern, bahkan untuk bebelanja masyarakat memilih ritel modern sebagai alternative utama, hal ini tentunya menyebabkan banyaknya bisnis ritelyang lahir di Indonesia.
    Kehadiran bebagai ritel modern pada satu sisi sangat menggembirakan konsumen. ritel modern menawarkan berbagai hal positif kepada konsumen antara lain kenyamanan saat berbelanja, keamanan, kemudahan, variasi produk yang semakin beragam, kualitas produk yang terus meningkat dan tentu saja harga produk yang menjadi lebih murah sehingga mempengaruhi keputusan pembelian konsumen.proses pembelian dimulai ketika konsumen mengenali adanya kebutuhan yang belum terpenuhi. konsumen mulai mencari informasi tentang cara memenuhi kebutuhan tersebut meliputi produk apa yang dibutuhkan dan bagaimana memperolehnya. konsumen kemudian mengevaluasi berbagai alternatif produk melalui ritel, katalog dan internet hingga memilih salah satu diantaranya. Pada suatu kondisi, konsumen akan sangat mempetimbangkan ritel dan produk yang akan dibeli dan membutuhkan waktu. Setelah mengevaluasi, konsumen akan membuat keputusan pembelian pada suatu ritel
    Berkembangnya bisnis ritel di Indonesia beberapa tahun terakhir ini cukup tinggi. Hal ini dibuktikan dengan semakin banyaknya perusahaan yang terjun pada bisnis ritel tersebut. Banyaknya perusahaan yang terjun pada bisnis ritel , tidak lepas dari banyaknya tuntutan konsumen untuk memenuhi kebutuhannya sehingga persaingan yang terjadi semakin ketat yang pada akhirnya perusahaan yang memiliki citra yang baik yang akan mampu mempengaruhi keputusan pembelian konsumen
    Pembentukan cira atau image yang baik di benak konsumen dapat menjadi kekuatan ritel tersebut dalam memperebutkan calon konsumen potensial dan mempertahankan konsumen yang ada. Citra toko adalah kepribadian sebuah toko yang menggambarkan apa ang dilihat dan dirasakan oleh konsumen terhadap toko tertentu (sopiah dan Syihabudin, 2008 : 138). Pembentukan citra sebuah toko selain dipengaruhi oleh kualitas produk, harga, dan kualitas pelayanan juga dipengaruhi keberadaan lokasi toko dan fasilitas fisik. Mencitakan sebuah citra yang baik bagi konsumen berarti memuaskan konsumen, mengingat konsumen yang merasa puas diharapkan akan melakukan pembelian ulang dan bahkan menginformasikannya kepada orang lain, hal ini akan membuat ritel tersebut semakin diminati konsumen.
    Mini market merupakan salah satu bentuk ritel modern yang berkembang selain Hipermarket dan Supermarket. mini market berbeda dari Hipermarket dan supermarket dikarenakan bentuk skala usahanya yang tidak sebesar kedua ritel tersebut, walaupun berbentuk skala kecil mini market mampu bersaing dengan ritel-ritel lainnya. hal ini dibuktikan dengan banyaknya konsumen yang berbelanja di mini market.
    Tri D Mart merupakan ritel modern dalam bentuk mini maket yang terletak di Jl.H.A.Manaf, samping UNJA Telanai, kota Jambi. Mini market ini telah cukup lama berdiri serta memiliki banyak pelanggan baik dari kalangan masyarakat umum maupun dari mahasiswa unja telanai sendiri hal ini menyebabkan kemajuan yang pesat pada mini market ini. Lokasi toko yang strategi merupakan salah satu faktor pendorong yang menjanjikan karena terletak di samping kampus unja telanai serta terletak dipinggir jalan umum selain itu kualitas pelayanan harga produk dan fasilitas fisik turut berpartisipasi dalam kemajuan mini market ini.
    Berdasarkan uraian di atas peneliti tertarik untuk melakukan penelitian tentang aspek citra toko pada mini market Tri D Mart dengan judul ” PENGARUH CITRA TOKO TERHADAP MINAT BELI KONSUMEN PADA MINI MARKET TRI D MART”

    1.2. Rumusan Masalah
    Berdasarkan Latar belakang yang diuraikan, maka penulis mengidentifikasikan rumusan masalah dalam penelitian ini adalah sebagai berikut yaitu :
    – Apakah Citra toko yang terbentuk mempengaruhi minat beli konsumen pada mini market Tri D Mart ?
    – Apakah Variabel dalam citra toko yang paling berpengaruh terhadap meningkatnya minat beli konsumen?

    1.3. Tujuan Penelitian
    Berdasarkan rumusan masalah yang diuraikan maka tujuan penelitian yang ingin penulis teliti adalah sebagai berikut yaitu:<